mRNA_M-pyrifera_M_contig81649.19114.1 (mRNA) Macrocystis pyrifera P11B4 male
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig81649.19114.1 vs. uniprot
Match: UPI001AC45BD4 (Uncharacterized protein n=1 Tax=Phycisphaerales bacterium TaxID=2052180 RepID=UPI001AC45BD4) HSP 1 Score: 55.1 bits (131), Expect = 1.700e-7 Identity = 30/82 (36.59%), Postives = 53/82 (64.63%), Query Frame = 1 Query: 10 MITLAQASVDAS-FWIWLGVLVLVVLVGGAVLLGVRRRMFSDETQADFQAGGILEQLRTLRNEGKISKEEYEQTRKSLIAKV 252 M LAQ + D + +WLG+ ++ V++ G ++ VRRR+ + + + G L++LR +R+ GK++KEEY+ RKSL A++ Sbjct: 7 MTLLAQQTRDPTRLLLWLGIFIVAVVILGVAIMMVRRRVLGSDMSRETEQG-FLDELRQMRDSGKMTKEEYDLARKSLTARL 87
BLAST of mRNA_M-pyrifera_M_contig81649.19114.1 vs. uniprot
Match: A0A2E3RRD9_9BACT (Uncharacterized protein n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2E3RRD9_9BACT) HSP 1 Score: 53.5 bits (127), Expect = 5.550e-7 Identity = 30/73 (41.10%), Postives = 48/73 (65.75%), Query Frame = 1 Query: 55 WLGVLVLVVLVGGAVLLGVRRRMFSDETQADFQAGGILEQLRTLRNEGKISKEEYEQTRKSLIAKVSEHKPET 273 WLG+L+LVV+VGGA +L +RR + ++Q Q G LE +R L G++S EE+++ R++LI + H E+ Sbjct: 33 WLGLLLLVVIVGGAFVLMIRR---TTKSQGPGQGGFTLEDIRQLHRSGELSDEEFQKAREALIQQARSHDGES 102
BLAST of mRNA_M-pyrifera_M_contig81649.19114.1 vs. uniprot
Match: A0A4P5X8Q6_9BACT (Uncharacterized protein n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A4P5X8Q6_9BACT) HSP 1 Score: 50.4 bits (119), Expect = 9.980e-6 Identity = 36/89 (40.45%), Postives = 55/89 (61.80%), Query Frame = 1 Query: 7 MMITLAQASVDASF---WIWLGVLVLVVLVGGAVLLGVRRRMFSDETQADFQAG--GILEQLRTLRNEGKISKEEYEQTRKSLIAKVSE 258 M+ LAQ++ A+ W+ V+ ++VL GGA+L VR+ M + D G G+LE +R +R+EGK+S EEY+Q RK +I K +E Sbjct: 1 MIFLLAQSTKQANNVVPWVIALVIAVLVLFGGALL--VRKWML----RGDISPGDEGLLESMRRMRDEGKLSDEEYQQARKQMIGKAAE 83 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig81649.19114.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig81649.19114.1 >prot_M-pyrifera_M_contig81649.19114.1 ID=prot_M-pyrifera_M_contig81649.19114.1|Name=mRNA_M-pyrifera_M_contig81649.19114.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=103bp MMITLAQASVDASFWIWLGVLVLVVLVGGAVLLGVRRRMFSDETQADFQAback to top mRNA from alignment at M-pyrifera_M_contig81649:426..740+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig81649.19114.1 ID=mRNA_M-pyrifera_M_contig81649.19114.1|Name=mRNA_M-pyrifera_M_contig81649.19114.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=315bp|location=Sequence derived from alignment at M-pyrifera_M_contig81649:426..740+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig81649:426..740+ >mRNA_M-pyrifera_M_contig81649.19114.1 ID=mRNA_M-pyrifera_M_contig81649.19114.1|Name=mRNA_M-pyrifera_M_contig81649.19114.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=618bp|location=Sequence derived from alignment at M-pyrifera_M_contig81649:426..740+ (Macrocystis pyrifera P11B4 male)back to top |