mRNA_M-pyrifera_M_contig81643.19109.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig81643.19109.1 vs. uniprot
Match: A0A0D2X5D7_CAPO3 (Kinesin family member 1C n=2 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2X5D7_CAPO3) HSP 1 Score: 51.2 bits (121), Expect = 2.490e-5 Identity = 24/72 (33.33%), Postives = 40/72 (55.56%), Query Frame = 1 Query: 58 YHTFTVKVAAGKLTWNAEPRFSDFVAFHKTVRKLFPSLPLMKFPSKQPTKKQTEQFVRKRALKLERYLRAAL 273 +H + V++ G W+ + R+S F FH +R FPS + FP ++ + FV +R ++LE YLR A+ Sbjct: 1370 FHFYIVRIRVGDNVWDLQRRYSQFREFHLAIRSKFPSGVKIMFPPRKTIGHRNPDFVERRRIRLESYLRCAI 1441 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig81643.19109.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig81643.19109.1 >prot_M-pyrifera_M_contig81643.19109.1 ID=prot_M-pyrifera_M_contig81643.19109.1|Name=mRNA_M-pyrifera_M_contig81643.19109.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=85bp MHIPSHGDGYHTFTVKVAAGKLTWNAEPRFSDFVAFHKTVRKLFPSLPLMback to top mRNA from alignment at M-pyrifera_M_contig81643:305..589+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig81643.19109.1 ID=mRNA_M-pyrifera_M_contig81643.19109.1|Name=mRNA_M-pyrifera_M_contig81643.19109.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=285bp|location=Sequence derived from alignment at M-pyrifera_M_contig81643:305..589+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig81643:305..589+ >mRNA_M-pyrifera_M_contig81643.19109.1 ID=mRNA_M-pyrifera_M_contig81643.19109.1|Name=mRNA_M-pyrifera_M_contig81643.19109.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=510bp|location=Sequence derived from alignment at M-pyrifera_M_contig81643:305..589+ (Macrocystis pyrifera P11B4 male)back to top |