mRNA_M-pyrifera_M_contig100857.191.1 (mRNA) Macrocystis pyrifera P11B4 male
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig100857.191.1 vs. uniprot
Match: A0A5A8CFC9_CAFRO (Uncharacterized protein n=4 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8CFC9_CAFRO) HSP 1 Score: 101 bits (251), Expect = 8.210e-23 Identity = 52/99 (52.53%), Postives = 65/99 (65.66%), Query Frame = 1 Query: 7 EAAVRRSFTLMALLTGAHGLGERLLSLRAAASYKSLIRVFDPECRGSFHHVCAVLQKLVLSRPADVAAAVLDSGPTHIQRMLRFLHHPPVADTVLQLLT 303 E A S TL LL G G LL+ + SL+RVF P RGSFHH C VLQ+LVL+ P DVA A++ GP ++R++ FLHHPPVADT++QLLT Sbjct: 472 EGAQATSLTLTRLLIKPDGDGCALLAAAPREATASLLRVFSPHSRGSFHHACTVLQRLVLAHPHDVAEALVALGPAPLRRLMAFLHHPPVADTLIQLLT 570 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig100857.191.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig100857.191.1 >prot_M-pyrifera_M_contig100857.191.1 ID=prot_M-pyrifera_M_contig100857.191.1|Name=mRNA_M-pyrifera_M_contig100857.191.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=101bp EEEAAVRRSFTLMALLTGAHGLGERLLSLRAAASYKSLIRVFDPECRGSFback to top mRNA from alignment at M-pyrifera_M_contig100857:356..658- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig100857.191.1 ID=mRNA_M-pyrifera_M_contig100857.191.1|Name=mRNA_M-pyrifera_M_contig100857.191.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=303bp|location=Sequence derived from alignment at M-pyrifera_M_contig100857:356..658- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig100857:356..658- >mRNA_M-pyrifera_M_contig100857.191.1 ID=mRNA_M-pyrifera_M_contig100857.191.1|Name=mRNA_M-pyrifera_M_contig100857.191.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=606bp|location=Sequence derived from alignment at M-pyrifera_M_contig100857:356..658- (Macrocystis pyrifera P11B4 male)back to top |