prot_M-pyrifera_M_contig81556.19086.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig81556.19086.1 vs. uniprot
Match: A0A0H4XER5_9DELT (Uncharacterized protein n=1 Tax=Myxococcus hansupus TaxID=1297742 RepID=A0A0H4XER5_9DELT) HSP 1 Score: 60.8 bits (146), Expect = 2.670e-9 Identity = 29/63 (46.03%), Postives = 36/63 (57.14%), Query Frame = 0 Query: 3 GYRDADGVVVIPPIYKFASKEFNEGLAYVVAKDRRGYIHPDGSWAFDAKFTYCDKFVNGRARV 65 G+ D G VIP IY F +G+A V R GY+HPDGSWA + +FT F +GRA V Sbjct: 236 GFIDRSGQQVIPAIYDAVMGGFFQGVAPVKQGTRFGYLHPDGSWALEPRFTMAQPFADGRAAV 298 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig81556.19086.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig81556.19086.1 ID=prot_M-pyrifera_M_contig81556.19086.1|Name=mRNA_M-pyrifera_M_contig81556.19086.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=67bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|