prot_M-pyrifera_M_contig81537.19075.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig81537.19075.1 vs. uniprot
Match: D7FV43_ECTSI (Peptidylprolyl isomerase n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FV43_ECTSI) HSP 1 Score: 62.8 bits (151), Expect = 1.400e-11 Identity = 27/30 (90.00%), Postives = 30/30 (100.00%), Query Frame = 0 Query: 1 MSLGEKAVLRCTSDYAYGPQGAGGVIPPNA 30 MSLGEKA+L+CTSDYAYGP+GAGGVIPPNA Sbjct: 67 MSLGEKAILKCTSDYAYGPEGAGGVIPPNA 96
BLAST of mRNA_M-pyrifera_M_contig81537.19075.1 vs. uniprot
Match: A0A7S4UZB0_9DINO (Peptidylprolyl isomerase n=1 Tax=Alexandrium monilatum TaxID=311494 RepID=A0A7S4UZB0_9DINO) HSP 1 Score: 60.5 bits (145), Expect = 1.610e-10 Identity = 30/40 (75.00%), Postives = 32/40 (80.00%), Query Frame = 0 Query: 1 MSLGEKAVLRCTSDYAYGPQGAGGVIPPNAGKTDPSHNLQ 40 MSLGEKAVL+ TSDY YGPQGAGGVIPPNA T H L+ Sbjct: 87 MSLGEKAVLQMTSDYGYGPQGAGGVIPPNADLTFAVHLLK 126
BLAST of mRNA_M-pyrifera_M_contig81537.19075.1 vs. uniprot
Match: A0A7S2MD69_9STRA (Peptidylprolyl isomerase n=1 Tax=Helicotheca tamesis TaxID=374047 RepID=A0A7S2MD69_9STRA) HSP 1 Score: 58.2 bits (139), Expect = 9.300e-10 Identity = 26/30 (86.67%), Postives = 28/30 (93.33%), Query Frame = 0 Query: 1 MSLGEKAVLRCTSDYAYGPQGAGGVIPPNA 30 MSLGEKA+LR TSDY YGP+GAGGVIPPNA Sbjct: 68 MSLGEKAILRITSDYGYGPRGAGGVIPPNA 97
BLAST of mRNA_M-pyrifera_M_contig81537.19075.1 vs. uniprot
Match: A0A7S4K440_9STRA (Peptidylprolyl isomerase n=1 Tax=Odontella aurita TaxID=265563 RepID=A0A7S4K440_9STRA) HSP 1 Score: 55.5 bits (132), Expect = 9.710e-9 Identity = 25/30 (83.33%), Postives = 27/30 (90.00%), Query Frame = 0 Query: 1 MSLGEKAVLRCTSDYAYGPQGAGGVIPPNA 30 MSLGEK+VL TSDY YGP+GAGGVIPPNA Sbjct: 68 MSLGEKSVLHITSDYGYGPRGAGGVIPPNA 97
BLAST of mRNA_M-pyrifera_M_contig81537.19075.1 vs. uniprot
Match: A0A6U6YDL3_9DINO (Peptidylprolyl isomerase n=1 Tax=Alexandrium andersonii TaxID=327968 RepID=A0A6U6YDL3_9DINO) HSP 1 Score: 55.1 bits (131), Expect = 2.750e-8 Identity = 26/33 (78.79%), Postives = 27/33 (81.82%), Query Frame = 0 Query: 1 MSLGEKAVLRCTSDYAYGPQGAGGVIPPNAGKT 33 MSLGEKA+LR TSDY YG GAGGVIPPNA T Sbjct: 103 MSLGEKAILRMTSDYGYGASGAGGVIPPNADLT 135
BLAST of mRNA_M-pyrifera_M_contig81537.19075.1 vs. uniprot
Match: B8C7M8_THAPS (Peptidylprolyl isomerase n=1 Tax=Thalassiosira pseudonana TaxID=35128 RepID=B8C7M8_THAPS) HSP 1 Score: 54.3 bits (129), Expect = 3.000e-8 Identity = 25/30 (83.33%), Postives = 27/30 (90.00%), Query Frame = 0 Query: 1 MSLGEKAVLRCTSDYAYGPQGAGGVIPPNA 30 MSLGEKA+LR TSDY YG +GAGGVIPPNA Sbjct: 68 MSLGEKAMLRITSDYGYGARGAGGVIPPNA 97
BLAST of mRNA_M-pyrifera_M_contig81537.19075.1 vs. uniprot
Match: A0A812UMS3_9DINO (Peptidylprolyl isomerase n=1 Tax=Symbiodinium natans TaxID=878477 RepID=A0A812UMS3_9DINO) HSP 1 Score: 52.4 bits (124), Expect = 9.010e-8 Identity = 25/33 (75.76%), Postives = 27/33 (81.82%), Query Frame = 0 Query: 1 MSLGEKAVLRCTSDYAYGPQGAGGVIPPNAGKT 33 MSLGEKA+LR TSDY YG +GAG VIPPNA T Sbjct: 43 MSLGEKAILRMTSDYGYGSRGAGRVIPPNADLT 75
BLAST of mRNA_M-pyrifera_M_contig81537.19075.1 vs. uniprot
Match: A0A7S4V7C6_9DINO (Peptidylprolyl isomerase n=3 Tax=Alexandrium monilatum TaxID=311494 RepID=A0A7S4V7C6_9DINO) HSP 1 Score: 53.1 bits (126), Expect = 1.400e-7 Identity = 25/33 (75.76%), Postives = 27/33 (81.82%), Query Frame = 0 Query: 1 MSLGEKAVLRCTSDYAYGPQGAGGVIPPNAGKT 33 MSLGEKA+LR TSD+ YG GAGGVIPPNA T Sbjct: 98 MSLGEKAILRMTSDFGYGAAGAGGVIPPNADLT 130
BLAST of mRNA_M-pyrifera_M_contig81537.19075.1 vs. uniprot
Match: A0A7S2P014_9DINO (Peptidylprolyl isomerase n=1 Tax=Brandtodinium nutricula TaxID=1333877 RepID=A0A7S2P014_9DINO) HSP 1 Score: 53.1 bits (126), Expect = 1.550e-7 Identity = 25/33 (75.76%), Postives = 28/33 (84.85%), Query Frame = 0 Query: 1 MSLGEKAVLRCTSDYAYGPQGAGGVIPPNAGKT 33 MSLGEKAVL+ TSD+ YG +GAGGVIPPNA T Sbjct: 104 MSLGEKAVLKMTSDFGYGARGAGGVIPPNADLT 136
BLAST of mRNA_M-pyrifera_M_contig81537.19075.1 vs. uniprot
Match: K0T5E5_THAOC (Peptidylprolyl isomerase (Fragment) n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0T5E5_THAOC) HSP 1 Score: 53.5 bits (127), Expect = 1.640e-7 Identity = 25/30 (83.33%), Postives = 26/30 (86.67%), Query Frame = 0 Query: 1 MSLGEKAVLRCTSDYAYGPQGAGGVIPPNA 30 MSLGEKA+LR TSDY YG GAGGVIPPNA Sbjct: 88 MSLGEKAMLRITSDYGYGSAGAGGVIPPNA 117 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig81537.19075.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig81537.19075.1 ID=prot_M-pyrifera_M_contig81537.19075.1|Name=mRNA_M-pyrifera_M_contig81537.19075.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=42bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|