prot_M-pyrifera_M_contig8061.18871.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8061.18871.1 vs. uniprot
Match: D7G4C1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G4C1_ECTSI) HSP 1 Score: 76.3 bits (186), Expect = 1.820e-14 Identity = 40/84 (47.62%), Postives = 52/84 (61.90%), Query Frame = 0 Query: 2 IKQLQLTCTSVCSDCRASSVFHVRVVSRTPRRLWTTARGPNRRRRSGKGAGVPGLPPLRVGRLTFGEYYNRAISAVALPSELTK 85 +KQLQL S+CS+ RA + FH+RVV RTP+RLWTT +GK G G+PP+RV LTF EY+ A+ V + L K Sbjct: 11 VKQLQLASLSICSESRACTAFHLRVVRRTPKRLWTTTSS------TGKRVGTDGVPPMRVDWLTFREYFEPAVRNVVWRAGLRK 88 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8061.18871.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig8061.18871.1 ID=prot_M-pyrifera_M_contig8061.18871.1|Name=mRNA_M-pyrifera_M_contig8061.18871.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=162bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|