prot_M-pyrifera_M_contig80404.18834.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig80404.18834.1 vs. uniprot
Match: D7FN51_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FN51_ECTSI) HSP 1 Score: 70.1 bits (170), Expect = 6.760e-13 Identity = 31/37 (83.78%), Postives = 34/37 (91.89%), Query Frame = 0 Query: 7 SRTLSDVHTLRLHTYYVPTFCDVCSQLLIGIMQQGLR 43 SRTLS VH+ RLH+YY PTFCDVCSQLLIGIMQQGL+ Sbjct: 136 SRTLSVVHSFRLHSYYAPTFCDVCSQLLIGIMQQGLQ 172
BLAST of mRNA_M-pyrifera_M_contig80404.18834.1 vs. uniprot
Match: A0A0B1SS03_OESDE (Phorbol-ester/DAG-type domain-containing protein n=1 Tax=Oesophagostomum dentatum TaxID=61180 RepID=A0A0B1SS03_OESDE) HSP 1 Score: 50.8 bits (120), Expect = 2.090e-7 Identity = 19/43 (44.19%), Postives = 29/43 (67.44%), Query Frame = 0 Query: 1 RTCGAESRTLSDVHTLRLHTYYVPTFCDVCSQLLIGIMQQGLR 43 ++C R + HTL +H+Y PTFCD C +LL G+++QGL+ Sbjct: 5 QSCPQHERLVVHPHTLYVHSYKAPTFCDFCGELLFGLVKQGLK 47
BLAST of mRNA_M-pyrifera_M_contig80404.18834.1 vs. uniprot
Match: W2TME5_NECAM (Protein kinase C n=1 Tax=Necator americanus TaxID=51031 RepID=W2TME5_NECAM) HSP 1 Score: 53.9 bits (128), Expect = 3.410e-7 Identity = 21/43 (48.84%), Postives = 29/43 (67.44%), Query Frame = 0 Query: 1 RTCGAESRTLSDVHTLRLHTYYVPTFCDVCSQLLIGIMQQGLR 43 RTC R + HTL +H+Y PTFCD C +LL G+++QGL+ Sbjct: 30 RTCPQHERLVVHPHTLYVHSYKAPTFCDFCGELLFGLVKQGLK 72
BLAST of mRNA_M-pyrifera_M_contig80404.18834.1 vs. uniprot
Match: A0A0C2FV61_9BILA (Phorbol-ester/DAG-type domain-containing protein (Fragment) n=1 Tax=Ancylostoma duodenale TaxID=51022 RepID=A0A0C2FV61_9BILA) HSP 1 Score: 50.1 bits (118), Expect = 4.830e-7 Identity = 19/41 (46.34%), Postives = 27/41 (65.85%), Query Frame = 0 Query: 3 CGAESRTLSDVHTLRLHTYYVPTFCDVCSQLLIGIMQQGLR 43 C R + HTL +H+Y PTFCD C +LL G+++QGL+ Sbjct: 1 CPQHERLVVHPHTLYVHSYKAPTFCDFCGELLFGLVKQGLK 41
BLAST of mRNA_M-pyrifera_M_contig80404.18834.1 vs. uniprot
Match: H9IU60_BOMMO (Phorbol-ester/DAG-type domain-containing protein n=1 Tax=Bombyx mori TaxID=7091 RepID=H9IU60_BOMMO) HSP 1 Score: 51.6 bits (122), Expect = 9.820e-7 Identity = 20/40 (50.00%), Postives = 28/40 (70.00%), Query Frame = 0 Query: 4 GAESRTLSDVHTLRLHTYYVPTFCDVCSQLLIGIMQQGLR 43 G ES L HTL +H+Y PTFCD C ++L G+++QGL+ Sbjct: 96 GTESLPLMRPHTLAVHSYKAPTFCDFCGEMLFGLVRQGLK 135
BLAST of mRNA_M-pyrifera_M_contig80404.18834.1 vs. uniprot
Match: A0A0N4XR43_NIPBR (Phorbol-ester/DAG-type domain-containing protein n=1 Tax=Nippostrongylus brasiliensis TaxID=27835 RepID=A0A0N4XR43_NIPBR) HSP 1 Score: 49.7 bits (117), Expect = 1.080e-6 Identity = 19/41 (46.34%), Postives = 27/41 (65.85%), Query Frame = 0 Query: 3 CGAESRTLSDVHTLRLHTYYVPTFCDVCSQLLIGIMQQGLR 43 C R + HTL +H+Y PTFCD C +LL G+++QGL+ Sbjct: 41 CPHHERLVVHPHTLYVHSYKAPTFCDFCGELLFGLVKQGLK 81
BLAST of mRNA_M-pyrifera_M_contig80404.18834.1 vs. uniprot
Match: A0A3P7YNH8_HELPZ (Uncharacterized protein n=1 Tax=Heligmosomoides polygyrus TaxID=6339 RepID=A0A3P7YNH8_HELPZ) HSP 1 Score: 52.0 bits (123), Expect = 1.620e-6 Identity = 20/42 (47.62%), Postives = 29/42 (69.05%), Query Frame = 0 Query: 2 TCGAESRTLSDVHTLRLHTYYVPTFCDVCSQLLIGIMQQGLR 43 +C R + HTL +H+Y VPTFCD C +LL G+++QGL+ Sbjct: 119 SCPQHERLVVHPHTLYVHSYKVPTFCDFCGELLFGLVKQGLK 160
BLAST of mRNA_M-pyrifera_M_contig80404.18834.1 vs. uniprot
Match: K7HMI3_CAEJA (Phorbol-ester/DAG-type domain-containing protein n=2 Tax=Caenorhabditis japonica TaxID=281687 RepID=K7HMI3_CAEJA) HSP 1 Score: 51.2 bits (121), Expect = 2.000e-6 Identity = 20/41 (48.78%), Postives = 28/41 (68.29%), Query Frame = 0 Query: 3 CGAESRTLSDVHTLRLHTYYVPTFCDVCSQLLIGIMQQGLR 43 C R + HTL +H+Y VPTFCD C +LL G+++QGL+ Sbjct: 42 CPQNERIVVHPHTLFVHSYKVPTFCDFCGELLFGLVKQGLK 82
BLAST of mRNA_M-pyrifera_M_contig80404.18834.1 vs. uniprot
Match: DKF2_CAEBR (Serine/threonine-protein kinase dkf-2 n=1 Tax=Caenorhabditis briggsae TaxID=6238 RepID=DKF2_CAEBR) HSP 1 Score: 51.6 bits (122), Expect = 2.230e-6 Identity = 20/42 (47.62%), Postives = 29/42 (69.05%), Query Frame = 0 Query: 2 TCGAESRTLSDVHTLRLHTYYVPTFCDVCSQLLIGIMQQGLR 43 +C R + HTL +H+Y VPTFCD C +LL G+++QGL+ Sbjct: 303 SCPQNERIVVHPHTLFVHSYKVPTFCDFCGELLFGLVKQGLK 344
BLAST of mRNA_M-pyrifera_M_contig80404.18834.1 vs. uniprot
Match: DKF2_CAEEL (Serine/threonine-protein kinase dkf-2 n=4 Tax=Caenorhabditis elegans TaxID=6239 RepID=DKF2_CAEEL) HSP 1 Score: 51.6 bits (122), Expect = 2.230e-6 Identity = 20/42 (47.62%), Postives = 29/42 (69.05%), Query Frame = 0 Query: 2 TCGAESRTLSDVHTLRLHTYYVPTFCDVCSQLLIGIMQQGLR 43 +C R + HTL +H+Y VPTFCD C +LL G+++QGL+ Sbjct: 310 SCPQNERIVVHPHTLFVHSYKVPTFCDFCGELLFGLVKQGLK 351 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig80404.18834.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig80404.18834.1 ID=prot_M-pyrifera_M_contig80404.18834.1|Name=mRNA_M-pyrifera_M_contig80404.18834.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=44bpback to top |