mRNA_M-pyrifera_M_contig80234.18802.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig80234.18802.1 vs. uniprot
Match: A0A2E9VIV7_9PLAN (Uncharacterized protein n=1 Tax=Rubinisphaera sp. TaxID=2024857 RepID=A0A2E9VIV7_9PLAN) HSP 1 Score: 68.2 bits (165), Expect = 7.610e-12 Identity = 38/79 (48.10%), Postives = 50/79 (63.29%), Query Frame = 1 Query: 7 TTILSLVFCLQGCLGFSQKPE-LSSEQKLVIACHQLNVPAVVKLLNSGADVNARFGDEATTEHFQDPWFGGNPVTASQW 240 T +LSLV L+ S PE LS +Q+L++AC+QL+ V KLLNSGADVNA++ + E F+D W G P SQW Sbjct: 10 TILLSLVSALRAEDNNSANPESLSVDQQLILACYQLDEDQVQKLLNSGADVNAKYLSKNFNELFRDRWTEGYPAAVSQW 88
BLAST of mRNA_M-pyrifera_M_contig80234.18802.1 vs. uniprot
Match: A0A5C5XKC9_9PLAN (Ankyrin repeats (3 copies) n=1 Tax=Rubinisphaera italica TaxID=2527969 RepID=A0A5C5XKC9_9PLAN) HSP 1 Score: 56.2 bits (134), Expect = 1.830e-7 Identity = 34/78 (43.59%), Postives = 44/78 (56.41%), Query Frame = 1 Query: 19 SLVFCLQGCLGFSQKPELSSE-----QKLVIACHQLNVPAVVKLLNSGADVNARFGDEATTEHFQDPWFGGNPVTASQ 237 +LVF L L K +SE Q+L++AC+QL+ V KLLNSGADVNA+ + E F+D W G P SQ Sbjct: 10 TLVFSLVSALCAEDKNSANSESLSVDQQLILACYQLDEVQVQKLLNSGADVNAKILSKNFKELFRDHWTQGTPGAISQ 87 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig80234.18802.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig80234.18802.1 >prot_M-pyrifera_M_contig80234.18802.1 ID=prot_M-pyrifera_M_contig80234.18802.1|Name=mRNA_M-pyrifera_M_contig80234.18802.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=80bp MRTTILSLVFCLQGCLGFSQKPELSSEQKLVIACHQLNVPAVVKLLNSGAback to top mRNA from alignment at M-pyrifera_M_contig80234:711..950+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig80234.18802.1 ID=mRNA_M-pyrifera_M_contig80234.18802.1|Name=mRNA_M-pyrifera_M_contig80234.18802.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=240bp|location=Sequence derived from alignment at M-pyrifera_M_contig80234:711..950+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig80234:711..950+ >mRNA_M-pyrifera_M_contig80234.18802.1 ID=mRNA_M-pyrifera_M_contig80234.18802.1|Name=mRNA_M-pyrifera_M_contig80234.18802.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=480bp|location=Sequence derived from alignment at M-pyrifera_M_contig80234:711..950+ (Macrocystis pyrifera P11B4 male)back to top |