mRNA_M-pyrifera_M_contig79651.18693.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig79651.18693.1 vs. uniprot
Match: A0A7S4MKZ1_9EUKA (Hypothetical protein n=2 Tax=Vannella sp. CB-2014 TaxID=1487602 RepID=A0A7S4MKZ1_9EUKA) HSP 1 Score: 100 bits (249), Expect = 3.270e-23 Identity = 43/81 (53.09%), Postives = 64/81 (79.01%), Query Frame = 1 Query: 7 ELRLRRVKELLQSEKAHVAALDIVVDEYLYPLIRADILPHSTLKEVFCNLELIRNWNQTFLSALEAHLECGDTFGDLFMEM 249 E R+R V+ELL++E+ HV++LD+ + YL PL +ILP +T++ +F NLE+IRNWNQTFL+ LEA +ECG+T G +F++M Sbjct: 39 EKRMRVVRELLETERTHVSSLDVAISHYLAPLTATNILPPTTIRAIFSNLEVIRNWNQTFLAFLEAEIECGETLGSVFLQM 119
BLAST of mRNA_M-pyrifera_M_contig79651.18693.1 vs. uniprot
Match: UPI0018CCAB3F (rho guanine nucleotide exchange factor 7 isoform X2 n=1 Tax=Teleopsis dalmanni TaxID=139649 RepID=UPI0018CCAB3F) HSP 1 Score: 53.5 bits (127), Expect = 2.400e-6 Identity = 26/73 (35.62%), Postives = 43/73 (58.90%), Query Frame = 1 Query: 25 VKELLQSEKAHVAALDIVVDEYLYPLIRADILPHSTLKEVFCNLELIRNWNQTFLSALEAHLECGDTFGDLFM 243 +K+LL SE+AHVA ++ +++ +L PL+ +IL ++ CN + N + LS +E EC D G LF+ Sbjct: 83 LKDLLDSERAHVAEIEGLLENFLQPLLETEILTQDEYVQLMCNFVDVVNTHNELLSQME---ECNDRIGKLFL 152
BLAST of mRNA_M-pyrifera_M_contig79651.18693.1 vs. uniprot
Match: UPI0018CE2327 (uncharacterized protein LOC119687177 isoform X1 n=1 Tax=Teleopsis dalmanni TaxID=139649 RepID=UPI0018CE2327) HSP 1 Score: 53.5 bits (127), Expect = 2.430e-6 Identity = 26/73 (35.62%), Postives = 43/73 (58.90%), Query Frame = 1 Query: 25 VKELLQSEKAHVAALDIVVDEYLYPLIRADILPHSTLKEVFCNLELIRNWNQTFLSALEAHLECGDTFGDLFM 243 +K+LL SE+AHVA ++ +++ +L PL+ +IL ++ CN + N + LS +E EC D G LF+ Sbjct: 83 LKDLLDSERAHVAEIEGLLENFLQPLLETEILTQDEYVQLMCNFVDVVNTHNELLSQME---ECNDRIGKLFL 152
BLAST of mRNA_M-pyrifera_M_contig79651.18693.1 vs. uniprot
Match: A0A151ZD79_9MYCE (Pleckstrin (PH) domain-containing protein n=1 Tax=Tieghemostelium lacteum TaxID=361077 RepID=A0A151ZD79_9MYCE) HSP 1 Score: 51.6 bits (122), Expect = 1.150e-5 Identity = 26/65 (40.00%), Postives = 43/65 (66.15%), Query Frame = 1 Query: 13 RLRRVKELLQSEKAHVAALDIVVDEYLYPLIRAD--ILPHSTLKEVFCNLELIRNWNQTFLSALE 201 R R +KEL+Q+E+ V++L+ ++EYL PL + +L L E+FCN+E+I +N+ FL L+ Sbjct: 568 RARIIKELIQTEQTLVSSLNTCIEEYLIPLRVQEKPLLTMDQLNEIFCNIEVIHEFNKGFLKLLD 632
BLAST of mRNA_M-pyrifera_M_contig79651.18693.1 vs. uniprot
Match: A0A084VP67_ANOSI (Uncharacterized protein n=1 Tax=Anopheles sinensis TaxID=74873 RepID=A0A084VP67_ANOSI) HSP 1 Score: 49.7 bits (117), Expect = 5.570e-5 Identity = 26/72 (36.11%), Postives = 42/72 (58.33%), Query Frame = 1 Query: 28 KELLQSEKAHVAALDIVVDEYLYPLIRADILPHSTLKEVFCNLELIRNWNQTFLSALEAHLECGDTFGDLFM 243 ++LL+SEKAHVA L +V+ ++ PL + IL + ++ CN + ++ FL LE EC D G +F+ Sbjct: 85 RDLLESEKAHVAELRGLVENFMEPLETSQILTGNEYAQLLCNFLEVVEMHEEFLQTLE---ECNDRVGKVFL 153
BLAST of mRNA_M-pyrifera_M_contig79651.18693.1 vs. uniprot
Match: A0A182JEI5_9DIPT (Uncharacterized protein n=1 Tax=Anopheles atroparvus TaxID=41427 RepID=A0A182JEI5_9DIPT) HSP 1 Score: 49.3 bits (116), Expect = 7.650e-5 Identity = 26/72 (36.11%), Postives = 42/72 (58.33%), Query Frame = 1 Query: 28 KELLQSEKAHVAALDIVVDEYLYPLIRADILPHSTLKEVFCNLELIRNWNQTFLSALEAHLECGDTFGDLFM 243 ++LL+SEKAHVA L +V+ +L PL + IL + ++ CN + ++ FL LE +C D G +F+ Sbjct: 85 RDLLESEKAHVAELRGLVENFLEPLEASQILSANEYTQLMCNFLEVVEMHEEFLQTLE---DCNDRVGKVFL 153 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig79651.18693.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig79651.18693.1 >prot_M-pyrifera_M_contig79651.18693.1 ID=prot_M-pyrifera_M_contig79651.18693.1|Name=mRNA_M-pyrifera_M_contig79651.18693.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=83bp MRELRLRRVKELLQSEKAHVAALDIVVDEYLYPLIRADILPHSTLKEVFCback to top mRNA from alignment at M-pyrifera_M_contig79651:573..821+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig79651.18693.1 ID=mRNA_M-pyrifera_M_contig79651.18693.1|Name=mRNA_M-pyrifera_M_contig79651.18693.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=249bp|location=Sequence derived from alignment at M-pyrifera_M_contig79651:573..821+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig79651:573..821+ >mRNA_M-pyrifera_M_contig79651.18693.1 ID=mRNA_M-pyrifera_M_contig79651.18693.1|Name=mRNA_M-pyrifera_M_contig79651.18693.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=498bp|location=Sequence derived from alignment at M-pyrifera_M_contig79651:573..821+ (Macrocystis pyrifera P11B4 male)back to top |