mRNA_M-pyrifera_M_contig7935.18634.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7935.18634.1 vs. uniprot
Match: D7G5J5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G5J5_ECTSI) HSP 1 Score: 91.7 bits (226), Expect = 7.140e-21 Identity = 42/48 (87.50%), Postives = 44/48 (91.67%), Query Frame = 1 Query: 1 MEGFAGFPLPAGLGPEFAGQPRRRLPKAPPLEIMRDEHDLSQYCLQDD 144 MEGFAGFPL GLGPEFAGQPRRRLPKAP LEIMR EHDLS+YCLQD+ Sbjct: 74 MEGFAGFPLAPGLGPEFAGQPRRRLPKAPSLEIMRGEHDLSEYCLQDE 121
BLAST of mRNA_M-pyrifera_M_contig7935.18634.1 vs. uniprot
Match: A0A6H5JUZ5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUZ5_9PHAE) HSP 1 Score: 91.7 bits (226), Expect = 2.110e-20 Identity = 42/48 (87.50%), Postives = 44/48 (91.67%), Query Frame = 1 Query: 1 MEGFAGFPLPAGLGPEFAGQPRRRLPKAPPLEIMRDEHDLSQYCLQDD 144 MEGFAGFPL GLGPEFAGQPRRRLPKAP LEIMR EHDLS+YCLQD+ Sbjct: 73 MEGFAGFPLAPGLGPEFAGQPRRRLPKAPSLEIMRGEHDLSEYCLQDE 120 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7935.18634.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig7935.18634.1 >prot_M-pyrifera_M_contig7935.18634.1 ID=prot_M-pyrifera_M_contig7935.18634.1|Name=mRNA_M-pyrifera_M_contig7935.18634.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=48bp MEGFAGFPLPAGLGPEFAGQPRRRLPKAPPLEIMRDEHDLSQYCLQDDback to top mRNA from alignment at M-pyrifera_M_contig7935:338..1736+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig7935.18634.1 ID=mRNA_M-pyrifera_M_contig7935.18634.1|Name=mRNA_M-pyrifera_M_contig7935.18634.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=1399bp|location=Sequence derived from alignment at M-pyrifera_M_contig7935:338..1736+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig7935:338..1736+ >mRNA_M-pyrifera_M_contig7935.18634.1 ID=mRNA_M-pyrifera_M_contig7935.18634.1|Name=mRNA_M-pyrifera_M_contig7935.18634.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=288bp|location=Sequence derived from alignment at M-pyrifera_M_contig7935:338..1736+ (Macrocystis pyrifera P11B4 male)back to top |