mRNA_M-pyrifera_M_contig792.18592.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig792.18592.1 vs. uniprot
Match: D7FYZ2_ECTSI (GBBH-like_N domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FYZ2_ECTSI) HSP 1 Score: 87.4 bits (215), Expect = 1.990e-20 Identity = 37/57 (64.91%), Postives = 45/57 (78.95%), Query Frame = 1 Query: 10 VDYTDVLESDRSVQIQWEDGRTSHYDFTWLRVNCPSCLHESGQRTVFPGDVRADLKP 180 V T VL ++R V++ W+DG S++D+TWLRVNCPS LHESGQRTVFPGDV LKP Sbjct: 80 VSSTQVLANERQVEVLWDDGHNSYFDYTWLRVNCPSFLHESGQRTVFPGDVDPGLKP 136
BLAST of mRNA_M-pyrifera_M_contig792.18592.1 vs. uniprot
Match: A0A6H5KBM7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KBM7_9PHAE) HSP 1 Score: 88.2 bits (217), Expect = 6.220e-19 Identity = 37/57 (64.91%), Postives = 46/57 (80.70%), Query Frame = 1 Query: 10 VDYTDVLESDRSVQIQWEDGRTSHYDFTWLRVNCPSCLHESGQRTVFPGDVRADLKP 180 V T+VL S+R V++ W+DG S++D+TWLRVNCPS LHESGQRT+FPGDV LKP Sbjct: 78 VSSTEVLPSERQVEVLWDDGHNSYFDYTWLRVNCPSFLHESGQRTLFPGDVDPGLKP 134
BLAST of mRNA_M-pyrifera_M_contig792.18592.1 vs. uniprot
Match: UPI00097D6471 (gamma-butyrobetaine dioxygenase n=1 Tax=Paralichthys olivaceus TaxID=8255 RepID=UPI00097D6471) HSP 1 Score: 48.1 bits (113), Expect = 8.480e-5 Identity = 22/46 (47.83%), Postives = 29/46 (63.04%), Query Frame = 1 Query: 7 AVDYTDVLESDRSVQIQWEDGRTSHYDFTWLRVNC--PSCLHESGQ 138 +V + LE R V+++W+DG TS Y FTWLR NC P C +S Q Sbjct: 65 SVRHARALEEARMVEVEWDDGGTSLYPFTWLRDNCQCPLCTLQSAQ 110 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig792.18592.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig792.18592.1 >prot_M-pyrifera_M_contig792.18592.1 ID=prot_M-pyrifera_M_contig792.18592.1|Name=mRNA_M-pyrifera_M_contig792.18592.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=63bp AAAVDYTDVLESDRSVQIQWEDGRTSHYDFTWLRVNCPSCLHESGQRTVFback to top mRNA from alignment at M-pyrifera_M_contig792:99..287- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig792.18592.1 ID=mRNA_M-pyrifera_M_contig792.18592.1|Name=mRNA_M-pyrifera_M_contig792.18592.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=189bp|location=Sequence derived from alignment at M-pyrifera_M_contig792:99..287- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig792:99..287- >mRNA_M-pyrifera_M_contig792.18592.1 ID=mRNA_M-pyrifera_M_contig792.18592.1|Name=mRNA_M-pyrifera_M_contig792.18592.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=378bp|location=Sequence derived from alignment at M-pyrifera_M_contig792:99..287- (Macrocystis pyrifera P11B4 male)back to top |