prot_M-pyrifera_M_contig78489.18446.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig78489.18446.1 vs. uniprot
Match: A0A078AC40_STYLE (CH_2 domain-containing protein n=1 Tax=Stylonychia lemnae TaxID=5949 RepID=A0A078AC40_STYLE) HSP 1 Score: 72.0 bits (175), Expect = 8.050e-14 Identity = 31/36 (86.11%), Postives = 33/36 (91.67%), Query Frame = 0 Query: 11 PALDELELQKIYNWIDEIPLSRPKRNITRDFSDGGK 46 PALDE E+Q IYNW+DEIPLSRPKRNI RDFSDGGK Sbjct: 4 PALDEEEMQMIYNWVDEIPLSRPKRNIARDFSDGGK 39
BLAST of mRNA_M-pyrifera_M_contig78489.18446.1 vs. uniprot
Match: A0A7S1CID1_9STRA (Hypothetical protein (Fragment) n=1 Tax=Bicosoecida sp. CB-2014 TaxID=1486930 RepID=A0A7S1CID1_9STRA) HSP 1 Score: 64.7 bits (156), Expect = 8.690e-12 Identity = 28/35 (80.00%), Postives = 32/35 (91.43%), Query Frame = 0 Query: 10 APALDELELQKIYNWIDEIPLSRPKRNITRDFSDG 44 A LD+ +LQKIY+W+DEIPLSRPKRNITRDFSDG Sbjct: 47 AAPLDDDQLQKIYSWVDEIPLSRPKRNITRDFSDG 81
BLAST of mRNA_M-pyrifera_M_contig78489.18446.1 vs. uniprot
Match: A0A0V0QAQ9_PSEPJ (Calponin homology domain n=1 Tax=Pseudocohnilembus persalinus TaxID=266149 RepID=A0A0V0QAQ9_PSEPJ) HSP 1 Score: 64.7 bits (156), Expect = 2.460e-11 Identity = 28/35 (80.00%), Postives = 31/35 (88.57%), Query Frame = 0 Query: 10 APALDELELQKIYNWIDEIPLSRPKRNITRDFSDG 44 AP L+E EL IYNWIDEIPLSRPK+NITRDF+DG Sbjct: 3 APPLNEEELNSIYNWIDEIPLSRPKKNITRDFADG 37
BLAST of mRNA_M-pyrifera_M_contig78489.18446.1 vs. uniprot
Match: J9JC92_9SPIT (DUF1042 multi-domain protein n=1 Tax=Oxytricha trifallax TaxID=1172189 RepID=J9JC92_9SPIT) HSP 1 Score: 64.7 bits (156), Expect = 3.930e-11 Identity = 28/33 (84.85%), Postives = 30/33 (90.91%), Query Frame = 0 Query: 11 PALDELELQKIYNWIDEIPLSRPKRNITRDFSD 43 PALDE E+Q IYNW+DEIPLSRPKRNI RDFSD Sbjct: 4 PALDEEEMQIIYNWVDEIPLSRPKRNIARDFSD 36
BLAST of mRNA_M-pyrifera_M_contig78489.18446.1 vs. uniprot
Match: A0A7S3F330_9EUKA (Hypothetical protein (Fragment) n=1 Tax=Haptolina ericina TaxID=156174 RepID=A0A7S3F330_9EUKA) HSP 1 Score: 60.5 bits (145), Expect = 1.340e-10 Identity = 24/38 (63.16%), Postives = 30/38 (78.95%), Query Frame = 0 Query: 7 HTSAPALDELELQKIYNWIDEIPLSRPKRNITRDFSDG 44 H +D+ ELQ++Y W+DEIPLSRPKRNI RDF+DG Sbjct: 9 HGKIEMMDDDELQRVYQWVDEIPLSRPKRNIARDFADG 46
BLAST of mRNA_M-pyrifera_M_contig78489.18446.1 vs. uniprot
Match: Q22DM0_TETTS (Sperm flagellar protein n=1 Tax=Tetrahymena thermophila (strain SB210) TaxID=312017 RepID=Q22DM0_TETTS) HSP 1 Score: 62.4 bits (150), Expect = 1.470e-10 Identity = 27/35 (77.14%), Postives = 31/35 (88.57%), Query Frame = 0 Query: 10 APALDELELQKIYNWIDEIPLSRPKRNITRDFSDG 44 AP L+E EL +IYNWID IPLSRPK+NITRDF+DG Sbjct: 3 APPLNEEELNQIYNWIDGIPLSRPKKNITRDFADG 37
BLAST of mRNA_M-pyrifera_M_contig78489.18446.1 vs. uniprot
Match: A0A6A5BQ61_NAEFO (Calponin-homology (CH) domain-containing protein n=1 Tax=Naegleria fowleri TaxID=5763 RepID=A0A6A5BQ61_NAEFO) HSP 1 Score: 62.4 bits (150), Expect = 1.720e-10 Identity = 26/36 (72.22%), Postives = 29/36 (80.56%), Query Frame = 0 Query: 9 SAPALDELELQKIYNWIDEIPLSRPKRNITRDFSDG 44 S P DE ELQ +Y W+DEIPLSRPK+NI RDFSDG Sbjct: 34 SVPPFDEEELQMLYTWVDEIPLSRPKKNIARDFSDG 69
BLAST of mRNA_M-pyrifera_M_contig78489.18446.1 vs. uniprot
Match: A0A7S1NEJ9_9EUGL (Hypothetical protein n=1 Tax=Eutreptiella gymnastica TaxID=73025 RepID=A0A7S1NEJ9_9EUGL) HSP 1 Score: 62.8 bits (151), Expect = 1.770e-10 Identity = 26/34 (76.47%), Postives = 29/34 (85.29%), Query Frame = 0 Query: 11 PALDELELQKIYNWIDEIPLSRPKRNITRDFSDG 44 P +DE ELQ +Y W+DEIPLSRPKRNI RDFSDG Sbjct: 5 PMMDENELQALYQWVDEIPLSRPKRNIARDFSDG 38
BLAST of mRNA_M-pyrifera_M_contig78489.18446.1 vs. uniprot
Match: A0A7J6MPF6_PERCH (Sperm flagellar 1 n=1 Tax=Perkinsus chesapeaki TaxID=330153 RepID=A0A7J6MPF6_PERCH) HSP 1 Score: 62.0 bits (149), Expect = 2.240e-10 Identity = 24/34 (70.59%), Postives = 30/34 (88.24%), Query Frame = 0 Query: 11 PALDELELQKIYNWIDEIPLSRPKRNITRDFSDG 44 P + E+QK+YNW+DEIPLSRPKRNI+RDF+DG Sbjct: 10 PLASDAEIQKLYNWVDEIPLSRPKRNISRDFADG 43
BLAST of mRNA_M-pyrifera_M_contig78489.18446.1 vs. uniprot
Match: C3YJ05_BRAFL (Calponin-homology (CH) domain-containing protein n=1 Tax=Branchiostoma floridae TaxID=7739 RepID=C3YJ05_BRAFL) HSP 1 Score: 62.0 bits (149), Expect = 2.480e-10 Identity = 27/35 (77.14%), Postives = 31/35 (88.57%), Query Frame = 0 Query: 10 APALDELELQKIYNWIDEIPLSRPKRNITRDFSDG 44 A LDE LQ++Y+WIDEIPLSRPK+NITRDFSDG Sbjct: 2 AGELDEESLQELYSWIDEIPLSRPKKNITRDFSDG 36 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig78489.18446.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig78489.18446.1 ID=prot_M-pyrifera_M_contig78489.18446.1|Name=mRNA_M-pyrifera_M_contig78489.18446.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=46bpback to top |