mRNA_M-pyrifera_M_contig77414.18226.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig77414.18226.1 vs. uniprot
Match: A0A0J1B3N3_RHOIS (Organization of plasma membrane n=1 Tax=Rhodopirellula islandica TaxID=595434 RepID=A0A0J1B3N3_RHOIS) HSP 1 Score: 71.6 bits (174), Expect = 7.280e-13 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = 3 Query: 123 MLRPIRHRFVPANCRAHGAQRRRSRMLTVFGLAPL 227 MLRPIRHRFVPANCRAHGAQRRRSRML +FGLAPL Sbjct: 1 MLRPIRHRFVPANCRAHGAQRRRSRMLAMFGLAPL 35
BLAST of mRNA_M-pyrifera_M_contig77414.18226.1 vs. uniprot
Match: Q7UXH0_RHOBA (Uncharacterized protein n=1 Tax=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) TaxID=243090 RepID=Q7UXH0_RHOBA) HSP 1 Score: 65.9 bits (159), Expect = 2.260e-12 Identity = 31/46 (67.39%), Postives = 33/46 (71.74%), Query Frame = -3 Query: 68 VSIRERRRCAP*ARQFAGTNRWRMGRNI*LDQQRDDVRHPCHRAVP 205 +SIR+RRRC P ARQ A WR GRNI LDQQRDDVRH HR P Sbjct: 1 MSIRDRRRCRPRARQLAEATEWRWGRNIGLDQQRDDVRHTGHRVFP 46
BLAST of mRNA_M-pyrifera_M_contig77414.18226.1 vs. uniprot
Match: F2B177_RHOBT (Uncharacterized protein n=2 Tax=Rhodopirellula baltica TaxID=265606 RepID=F2B177_RHOBT) HSP 1 Score: 62.8 bits (151), Expect = 1.910e-11 Identity = 30/46 (65.22%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 67 EGPPDDKGVEHHPAVDRVICCVPSAIGLSPRIAVLTVRSDGVPGCS 204 +G PDD+ VEHHPAVDRV+CCVP+AI L +AV V SDG GCS Sbjct: 23 QGRPDDQCVEHHPAVDRVLCCVPTAIQLPLPVAVPAVGSDGDLGCS 68 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig77414.18226.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig77414.18226.1 >prot_M-pyrifera_M_contig77414.18226.1 ID=prot_M-pyrifera_M_contig77414.18226.1|Name=mRNA_M-pyrifera_M_contig77414.18226.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=76bp CRLSHRCNCCDSIGRQNHHNRTEGPPDDKGVEHHPAVDRVICCVPSAIGLback to top mRNA from alignment at M-pyrifera_M_contig77414:118..345+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig77414.18226.1 ID=mRNA_M-pyrifera_M_contig77414.18226.1|Name=mRNA_M-pyrifera_M_contig77414.18226.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=228bp|location=Sequence derived from alignment at M-pyrifera_M_contig77414:118..345+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig77414:118..345+ >mRNA_M-pyrifera_M_contig77414.18226.1 ID=mRNA_M-pyrifera_M_contig77414.18226.1|Name=mRNA_M-pyrifera_M_contig77414.18226.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=456bp|location=Sequence derived from alignment at M-pyrifera_M_contig77414:118..345+ (Macrocystis pyrifera P11B4 male)back to top |