Homology
The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig76660.18069.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | | coord: 6..138 e-value: 4.4E-16 score: 60.4 |
IPR011990 | Tetratricopeptide-like helical domain superfamily | SUPERFAMILY | 48452 | TPR-like | coord: 45..138 |
IPR013026 | Tetratricopeptide repeat-containing domain | PROSITE | PS50293 | TPR_REGION | coord: 45..138 score: 9.16 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig76660.18069.1 ID=prot_M-pyrifera_M_contig76660.18069.1|Name=mRNA_M-pyrifera_M_contig76660.18069.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=138bp QERTRIDSLNEISYKLRKSDPQKSMRLGQTAMKLSSDYNYSEGKSRAYLN IGNAYRYLMQVDSGTYILRQGILFDLSQKNNEEDDKYNSLGLLFKRISET DSALFYFEHALNSRKLTNDSLAMASIYNNIGNVYKKIG back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR011990 | TPR-like_helical_dom_sf |
IPR013026 | TPR-contain_dom |
|