mRNA_M-pyrifera_M_contig7622.17973.1 (mRNA) Macrocystis pyrifera P11B4 male
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7622.17973.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 0 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig7622.17973.1 >prot_M-pyrifera_M_contig7622.17973.1 ID=prot_M-pyrifera_M_contig7622.17973.1|Name=mRNA_M-pyrifera_M_contig7622.17973.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=138bp MANACGGAKCYRRKDNKTCLAPNGWIVFRRVNQREFRPLLAKLTMYSQMKback to top mRNA from alignment at M-pyrifera_M_contig7622:6689..7163+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig7622.17973.1 ID=mRNA_M-pyrifera_M_contig7622.17973.1|Name=mRNA_M-pyrifera_M_contig7622.17973.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=475bp|location=Sequence derived from alignment at M-pyrifera_M_contig7622:6689..7163+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig7622:6689..7163+ >mRNA_M-pyrifera_M_contig7622.17973.1 ID=mRNA_M-pyrifera_M_contig7622.17973.1|Name=mRNA_M-pyrifera_M_contig7622.17973.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=828bp|location=Sequence derived from alignment at M-pyrifera_M_contig7622:6689..7163+ (Macrocystis pyrifera P11B4 male)back to top |