prot_M-pyrifera_M_contig76177.17966.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig76177.17966.1 vs. uniprot
Match: UPI00037D3768 (T9SS type A sorting domain-containing protein n=1 Tax=Lewinella cohaerens TaxID=70995 RepID=UPI00037D3768) HSP 1 Score: 58.9 bits (141), Expect = 6.050e-6 Identity = 36/62 (58.06%), Postives = 45/62 (72.58%), Query Frame = 0 Query: 235 ITRTWTATD--GFSSDTQVQLISVTDDTPPNFTSFPNTFSAECGDSLDPANTGGTPTASDDC 294 I RTWTAT G +S T VQ I++ D+ PP+F SFP+ + ECGDS DPA+TG TP+ASD C Sbjct: 692 IARTWTATSPCGITS-TCVQSITIVDNLPPSFVSFPSDTNVECGDSTDPADTG-TPSASDFC 751 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig76177.17966.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig76177.17966.1 ID=prot_M-pyrifera_M_contig76177.17966.1|Name=mRNA_M-pyrifera_M_contig76177.17966.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=304bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|