prot_M-pyrifera_M_contig75958.17919.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75958.17919.1 vs. uniprot
Match: A0A6H5KWI2_9PHAE (Mcl1_mid domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KWI2_9PHAE) HSP 1 Score: 103 bits (256), Expect = 1.270e-24 Identity = 45/55 (81.82%), Postives = 53/55 (96.36%), Query Frame = 0 Query: 1 QSFGWQWSPLLDTLKVSKNKKDRFWPVGLVTGKLLAATLKNGEEHPTAYPRPVLT 55 +SFGWQW+PLLDTLKVSK+K+ RFWPVG+V+GKLLAATLK+GEEHP AYPRPV+T Sbjct: 83 RSFGWQWTPLLDTLKVSKSKRYRFWPVGVVSGKLLAATLKDGEEHPAAYPRPVIT 137
BLAST of mRNA_M-pyrifera_M_contig75958.17919.1 vs. uniprot
Match: D7G152_ECTSI (Mcl1_mid domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G152_ECTSI) HSP 1 Score: 103 bits (256), Expect = 2.510e-24 Identity = 45/55 (81.82%), Postives = 53/55 (96.36%), Query Frame = 0 Query: 1 QSFGWQWSPLLDTLKVSKNKKDRFWPVGLVTGKLLAATLKNGEEHPTAYPRPVLT 55 +SFGWQW+PLLDTLKVSK+K+ RFWPVG+V+GKLLAATLK+GEEHP AYPRPV+T Sbjct: 564 RSFGWQWTPLLDTLKVSKSKRYRFWPVGVVSGKLLAATLKDGEEHPAAYPRPVIT 618 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75958.17919.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig75958.17919.1 ID=prot_M-pyrifera_M_contig75958.17919.1|Name=mRNA_M-pyrifera_M_contig75958.17919.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=55bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|