mRNA_M-pyrifera_M_contig75844.17890.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75844.17890.1 vs. uniprot
Match: D7FJE4_ECTSI (Annexin n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FJE4_ECTSI) HSP 1 Score: 95.5 bits (236), Expect = 1.270e-21 Identity = 46/55 (83.64%), Postives = 51/55 (92.73%), Query Frame = 1 Query: 1 RDFLTYTMLPEADFDALMLKEAMDGFGTNEGLIINILAPQSNARILAAKARHDQK 165 +DFL+Y +LPEADFDALMLK+AMDG GTNEGLII+ LAP SNARILAAKARHDQK Sbjct: 438 KDFLSYVLLPEADFDALMLKKAMDGLGTNEGLIISTLAPLSNARILAAKARHDQK 492
BLAST of mRNA_M-pyrifera_M_contig75844.17890.1 vs. uniprot
Match: A0A6H5L407_9PHAE (Annexin n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L407_9PHAE) HSP 1 Score: 95.5 bits (236), Expect = 1.270e-21 Identity = 46/55 (83.64%), Postives = 51/55 (92.73%), Query Frame = 1 Query: 1 RDFLTYTMLPEADFDALMLKEAMDGFGTNEGLIINILAPQSNARILAAKARHDQK 165 +DFL+Y +LPEADFDALMLK+AMDG GTNEGLII+ LAP SNARILAAKARHDQK Sbjct: 417 KDFLSYVLLPEADFDALMLKKAMDGLGTNEGLIISTLAPLSNARILAAKARHDQK 471
BLAST of mRNA_M-pyrifera_M_contig75844.17890.1 vs. uniprot
Match: A0A836CML3_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CML3_9STRA) HSP 1 Score: 59.3 bits (142), Expect = 6.910e-9 Identity = 27/54 (50.00%), Postives = 38/54 (70.37%), Query Frame = 1 Query: 4 DFLTYTMLPEADFDALMLKEAMDGFGTNEGLIINILAPQSNARILAAKARHDQK 165 D L +LP DFDA+M+K A DG GTNE ++I +LAP++NARI K ++D + Sbjct: 309 DLLVGAVLPYDDFDAIMVKRACDGVGTNEQILIELLAPRANARIRGMKLKYDAR 362
BLAST of mRNA_M-pyrifera_M_contig75844.17890.1 vs. uniprot
Match: A0A836CCJ5_9STRA (Annexin n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CCJ5_9STRA) HSP 1 Score: 58.9 bits (141), Expect = 9.510e-9 Identity = 28/55 (50.91%), Postives = 39/55 (70.91%), Query Frame = 1 Query: 1 RDFLTYTMLPEADFDALMLKEAMDGFGTNEGLIINILAPQSNARILAAKARHDQK 165 +D L +LP +FDA ++K+A DG GTNE ++I LAP+SN RI A KA++D K Sbjct: 450 QDLLMAIVLPYDEFDAAIIKKACDGLGTNEQVLIECLAPRSNGRIRALKAKYDAK 504
BLAST of mRNA_M-pyrifera_M_contig75844.17890.1 vs. uniprot
Match: A0A835YT40_9STRA (Anxa6 protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YT40_9STRA) HSP 1 Score: 57.4 bits (137), Expect = 3.320e-8 Identity = 24/55 (43.64%), Postives = 39/55 (70.91%), Query Frame = 1 Query: 1 RDFLTYTMLPEADFDALMLKEAMDGFGTNEGLIINILAPQSNARILAAKARHDQK 165 R + Y ++P D DA+++K+A DG GT+E L++ LAP SN+R++A KA+ + K Sbjct: 438 RQLMEYALMPTDDLDAMVVKQACDGLGTDETLLVEALAPLSNSRMIALKAKFEAK 492
BLAST of mRNA_M-pyrifera_M_contig75844.17890.1 vs. uniprot
Match: D8LG01_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LG01_ECTSI) HSP 1 Score: 48.9 bits (115), Expect = 3.270e-5 Identity = 21/53 (39.62%), Postives = 36/53 (67.92%), Query Frame = 1 Query: 1 RDFLTYTMLPEADFDALMLKEAMDGFGTNEGLIINILAPQSNARILAAKARHD 159 + F+ YT + +FDAL++K+AM G GT+E ++I +L + NA I AA+ ++ Sbjct: 349 KTFMVYTQMETQEFDALLMKKAMAGIGTDEDIMIMLLTTRDNAAIAAAQTYYE 401 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75844.17890.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig75844.17890.1 >prot_M-pyrifera_M_contig75844.17890.1 ID=prot_M-pyrifera_M_contig75844.17890.1|Name=mRNA_M-pyrifera_M_contig75844.17890.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=48bp MLPEADFDALMLKEAMDGFGTNEGLIINILAPQSNARILAAKARHDQKback to top mRNA from alignment at M-pyrifera_M_contig75844:773..937+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig75844.17890.1 ID=mRNA_M-pyrifera_M_contig75844.17890.1|Name=mRNA_M-pyrifera_M_contig75844.17890.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=165bp|location=Sequence derived from alignment at M-pyrifera_M_contig75844:773..937+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig75844:773..937+ >mRNA_M-pyrifera_M_contig75844.17890.1 ID=mRNA_M-pyrifera_M_contig75844.17890.1|Name=mRNA_M-pyrifera_M_contig75844.17890.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=288bp|location=Sequence derived from alignment at M-pyrifera_M_contig75844:773..937+ (Macrocystis pyrifera P11B4 male)back to top |