prot_M-pyrifera_M_contig7580.17879.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7580.17879.1 vs. uniprot
Match: A0A6H5L7V8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L7V8_9PHAE) HSP 1 Score: 60.1 bits (144), Expect = 3.420e-6 Identity = 58/102 (56.86%), Postives = 67/102 (65.69%), Query Frame = 0 Query: 242 GAAVAAADGTAPADDAKTRRANRLKRARLMTGHYKLAVMEHSSGQENAADGXXXXXXXXXXXVVLGETASGVGPGPSHDGGVGGSDASSSAGGLSDFDEESS 343 GA +AA+G ADD +TRRANRLKR RLM+GHYKLAV+EHSS Q++ + XXXXXXXXXXX DG GG+D SSA GLSD D SS Sbjct: 702 GAPSSAAEG-GRADDEETRRANRLKRMRLMSGHYKLAVLEHSSEQQHESAXXXXXXXXXXXXXXXXXXXXXX-----XDGDCGGTDDHSSADGLSDLDYTSS 797 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7580.17879.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig7580.17879.1 ID=prot_M-pyrifera_M_contig7580.17879.1|Name=mRNA_M-pyrifera_M_contig7580.17879.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=344bpback to top |