mRNA_M-pyrifera_M_contig75415.17796.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75415.17796.1 vs. uniprot
Match: A0A2T4WZE3_9BACT (50S ribosomal protein L21 n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2T4WZE3_9BACT) HSP 1 Score: 56.2 bits (134), Expect = 7.970e-9 Identity = 26/36 (72.22%), Postives = 29/36 (80.56%), Query Frame = 1 Query: 4 HTRGQKVLVFKKKRRKGYRKKQGFRQHLTVLSIDSI 111 H +G KV+VFKKKRRKGYRKK G RQH T + IDSI Sbjct: 66 HQKGDKVIVFKKKRRKGYRKKNGHRQHFTKIKIDSI 101
BLAST of mRNA_M-pyrifera_M_contig75415.17796.1 vs. uniprot
Match: A0A7C9B9F8_9BACT (50S ribosomal protein L21 n=1 Tax=Cytophagaceae bacterium SJW1-29 TaxID=2654236 RepID=A0A7C9B9F8_9BACT) HSP 1 Score: 56.2 bits (134), Expect = 7.970e-9 Identity = 26/37 (70.27%), Postives = 31/37 (83.78%), Query Frame = 1 Query: 1 EHTRGQKVLVFKKKRRKGYRKKQGFRQHLTVLSIDSI 111 EH +G+KV+VFKKKRRKGYRKK G RQ+LT + ID I Sbjct: 65 EHLKGEKVIVFKKKRRKGYRKKNGHRQYLTKIRIDDI 101
BLAST of mRNA_M-pyrifera_M_contig75415.17796.1 vs. uniprot
Match: A0A6B2LZU9_9BACT (50S ribosomal protein L21 n=1 Tax=Oceanipulchritudo coccoides TaxID=2706888 RepID=A0A6B2LZU9_9BACT) HSP 1 Score: 56.2 bits (134), Expect = 8.150e-9 Identity = 27/39 (69.23%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 1 EHTRGQKVLVFKKKRRKGYRKKQGFRQHLTVLSIDSITS 117 E+ RG+KVLVFKKKRRKGYR K+G RQ L+V+ I+SIT+ Sbjct: 66 ENKRGKKVLVFKKKRRKGYRNKRGHRQELSVIKIESITA 104
BLAST of mRNA_M-pyrifera_M_contig75415.17796.1 vs. uniprot
Match: A0A1M4URI7_9FLAO (50S ribosomal protein L21 n=3 Tax=Psychroflexus TaxID=83612 RepID=A0A1M4URI7_9FLAO) HSP 1 Score: 57.8 bits (138), Expect = 8.160e-9 Identity = 29/56 (51.79%), Postives = 40/56 (71.43%), Query Frame = 1 Query: 1 EHTRGQKVLVFKKKRRKGYRKKQGFRQHLTVLSIDSITSAFDQHEWPLPKEFPSKE 168 +H +G KV+VFKKKRRKGY+KK G RQ+LT + I+ +T++ + KE PSKE Sbjct: 76 KHLKGDKVIVFKKKRRKGYKKKNGHRQYLTEILIEGLTASGAKKSSASKKEEPSKE 131
BLAST of mRNA_M-pyrifera_M_contig75415.17796.1 vs. uniprot
Match: I0K2H1_9BACT (50S ribosomal protein L21 n=5 Tax=Cytophagales TaxID=768507 RepID=I0K2H1_9BACT) HSP 1 Score: 56.2 bits (134), Expect = 8.340e-9 Identity = 26/38 (68.42%), Postives = 32/38 (84.21%), Query Frame = 1 Query: 1 EHTRGQKVLVFKKKRRKGYRKKQGFRQHLTVLSIDSIT 114 EH +G+KV+VFKKKRRKGY+KK G RQ+LT L I+ IT Sbjct: 67 EHLKGEKVIVFKKKRRKGYKKKNGHRQYLTKLQINDIT 104
BLAST of mRNA_M-pyrifera_M_contig75415.17796.1 vs. uniprot
Match: UPI001BB80515 (50S ribosomal protein L21 n=1 Tax=Cryomorphaceae bacterium TaxID=1898111 RepID=UPI001BB80515) HSP 1 Score: 56.6 bits (135), Expect = 1.020e-8 Identity = 27/39 (69.23%), Postives = 31/39 (79.49%), Query Frame = 1 Query: 1 EHTRGQKVLVFKKKRRKGYRKKQGFRQHLTVLSIDSITS 117 EH +G KV+VFKKKRRKGYRKK G RQ+LT L I IT+ Sbjct: 65 EHLKGDKVIVFKKKRRKGYRKKNGHRQYLTSLEISGITA 103
BLAST of mRNA_M-pyrifera_M_contig75415.17796.1 vs. uniprot
Match: A0A5C6RNU3_9BACT (50S ribosomal protein L21 n=1 Tax=Phaeodactylibacter luteus TaxID=1564516 RepID=A0A5C6RNU3_9BACT) HSP 1 Score: 55.8 bits (133), Expect = 1.100e-8 Identity = 26/36 (72.22%), Postives = 29/36 (80.56%), Query Frame = 1 Query: 4 HTRGQKVLVFKKKRRKGYRKKQGFRQHLTVLSIDSI 111 H +G KVLVF+KKRRKGYRKK G RQH T + IDSI Sbjct: 65 HQKGDKVLVFRKKRRKGYRKKNGHRQHFTKIKIDSI 100
BLAST of mRNA_M-pyrifera_M_contig75415.17796.1 vs. uniprot
Match: A0A7Y3H307_9BACT (50S ribosomal protein L21 n=1 Tax=Saprospiraceae bacterium TaxID=2202734 RepID=A0A7Y3H307_9BACT) HSP 1 Score: 55.8 bits (133), Expect = 1.130e-8 Identity = 26/37 (70.27%), Postives = 29/37 (78.38%), Query Frame = 1 Query: 1 EHTRGQKVLVFKKKRRKGYRKKQGFRQHLTVLSIDSI 111 EH +G KV+VFKKKRRKGYR K G RQH T + IDSI Sbjct: 65 EHVKGDKVIVFKKKRRKGYRVKNGHRQHFTKIKIDSI 101
BLAST of mRNA_M-pyrifera_M_contig75415.17796.1 vs. uniprot
Match: A0A2D0MX55_9BACT (50S ribosomal protein L21 n=1 Tax=Flavilitoribacter nigricans DSM 23189 = NBRC 102662 TaxID=1122177 RepID=A0A2D0MX55_9BACT) HSP 1 Score: 55.8 bits (133), Expect = 1.130e-8 Identity = 26/37 (70.27%), Postives = 29/37 (78.38%), Query Frame = 1 Query: 1 EHTRGQKVLVFKKKRRKGYRKKQGFRQHLTVLSIDSI 111 EH +G KV+VFKKKRRKGYR K G RQH T + IDSI Sbjct: 65 EHVKGDKVIVFKKKRRKGYRVKNGHRQHFTKIKIDSI 101
BLAST of mRNA_M-pyrifera_M_contig75415.17796.1 vs. uniprot
Match: C6W6M4_DYAFD (50S ribosomal protein L21 n=29 Tax=Dyadobacter TaxID=120831 RepID=C6W6M4_DYAFD) HSP 1 Score: 55.8 bits (133), Expect = 1.130e-8 Identity = 26/39 (66.67%), Postives = 32/39 (82.05%), Query Frame = 1 Query: 1 EHTRGQKVLVFKKKRRKGYRKKQGFRQHLTVLSIDSITS 117 EH +G+KV+VFKKKRRKGYR K G RQ+LT +SID I + Sbjct: 65 EHLKGEKVIVFKKKRRKGYRVKNGHRQYLTKISIDEIVA 103 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75415.17796.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig75415.17796.1 >prot_M-pyrifera_M_contig75415.17796.1 ID=prot_M-pyrifera_M_contig75415.17796.1|Name=mRNA_M-pyrifera_M_contig75415.17796.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=57bp EHTRGQKVLVFKKKRRKGYRKKQGFRQHLTVLSIDSITSAFDQHEWPLPKback to top mRNA from alignment at M-pyrifera_M_contig75415:2..172+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig75415.17796.1 ID=mRNA_M-pyrifera_M_contig75415.17796.1|Name=mRNA_M-pyrifera_M_contig75415.17796.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=171bp|location=Sequence derived from alignment at M-pyrifera_M_contig75415:2..172+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig75415:2..172+ >mRNA_M-pyrifera_M_contig75415.17796.1 ID=mRNA_M-pyrifera_M_contig75415.17796.1|Name=mRNA_M-pyrifera_M_contig75415.17796.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=342bp|location=Sequence derived from alignment at M-pyrifera_M_contig75415:2..172+ (Macrocystis pyrifera P11B4 male)back to top |