prot_M-pyrifera_M_contig75367.17788.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75367.17788.1 vs. uniprot
Match: A0D7P8_PARTE (Uncharacterized protein n=1 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0D7P8_PARTE) HSP 1 Score: 59.3 bits (142), Expect = 9.480e-9 Identity = 28/61 (45.90%), Postives = 35/61 (57.38%), Query Frame = 0 Query: 2 ESQLRSEVGPQFGFDLADVYRHFAHRLAVRDALPALSAGVLVPLQARHRYGDHHHVLTYAR 62 + R EVGPQFGFDL + +H+ H +R L G +V L A H YG H HVL +AR Sbjct: 943 QENFRREVGPQFGFDLQQIGKHYVHIRQMRKQHKVLRNGQMVSLSAEHMYGWHTHVLAFAR 1003
BLAST of mRNA_M-pyrifera_M_contig75367.17788.1 vs. uniprot
Match: A0BEG4_PARTE (Uncharacterized protein n=1 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0BEG4_PARTE) HSP 1 Score: 55.5 bits (132), Expect = 2.120e-7 Identity = 26/57 (45.61%), Postives = 33/57 (57.89%), Query Frame = 0 Query: 6 RSEVGPQFGFDLADVYRHFAHRLAVRDALPALSAGVLVPLQARHRYGDHHHVLTYAR 62 R EVGPQFGFDL + +H+ + +R L G +V L A H YG H HVL + R Sbjct: 392 RREVGPQFGFDLQQIGKHYVYIRQIRKQHKVLRNGQIVSLSAEHMYGWHTHVLAFGR 448 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75367.17788.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig75367.17788.1 ID=prot_M-pyrifera_M_contig75367.17788.1|Name=mRNA_M-pyrifera_M_contig75367.17788.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=62bpback to top |