mRNA_M-pyrifera_M_contig7501.17721.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7501.17721.1 vs. uniprot
Match: UPI001CD4B748 (GIY-YIG nuclease family protein n=1 Tax=Rossellomorea aquimaris TaxID=189382 RepID=UPI001CD4B748) HSP 1 Score: 50.8 bits (120), Expect = 2.660e-6 Identity = 20/39 (51.28%), Postives = 27/39 (69.23%), Query Frame = 1 Query: 1 VYCLNLEGGNKYVGRTNNFDMRMKDHSLGDGAKWTQRHK 117 +Y L LEGGN YVG+T+N + R H G G++WTQ +K Sbjct: 12 IYILELEGGNYYVGQTDNLESRFSKHERGKGSQWTQIYK 50 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7501.17721.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig7501.17721.1 >prot_M-pyrifera_M_contig7501.17721.1 ID=prot_M-pyrifera_M_contig7501.17721.1|Name=mRNA_M-pyrifera_M_contig7501.17721.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=40bp VYCLNLEGGNKYVGRTNNFDMRMKDHSLGDGAKWTQRHK*back to top mRNA from alignment at M-pyrifera_M_contig7501:4169..4288+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig7501.17721.1 ID=mRNA_M-pyrifera_M_contig7501.17721.1|Name=mRNA_M-pyrifera_M_contig7501.17721.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=120bp|location=Sequence derived from alignment at M-pyrifera_M_contig7501:4169..4288+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig7501:4169..4288+ >mRNA_M-pyrifera_M_contig7501.17721.1 ID=mRNA_M-pyrifera_M_contig7501.17721.1|Name=mRNA_M-pyrifera_M_contig7501.17721.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=240bp|location=Sequence derived from alignment at M-pyrifera_M_contig7501:4169..4288+ (Macrocystis pyrifera P11B4 male)back to top |