mRNA_M-pyrifera_M_contig74839.17690.1 (mRNA) Macrocystis pyrifera P11B4 male
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74839.17690.1 vs. uniprot
Match: A0A6H5JLQ4_9PHAE (EF-hand domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JLQ4_9PHAE) HSP 1 Score: 111 bits (277), Expect = 4.840e-27 Identity = 54/58 (93.10%), Postives = 56/58 (96.55%), Query Frame = 1 Query: 1 QEHGRVEYEILLEIITARDVRRAHAFRQQTLEEGADFDELFTGIDNTARKRDFGGTLV 174 +EHGRVEYE LLEIITARDVRRAHAFRQQT EEGADFDELFTG+DNTARKRDFGGTLV Sbjct: 603 KEHGRVEYETLLEIITARDVRRAHAFRQQTAEEGADFDELFTGVDNTARKRDFGGTLV 660
BLAST of mRNA_M-pyrifera_M_contig74839.17690.1 vs. uniprot
Match: D8LCX6_ECTSI (EF-hand domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LCX6_ECTSI) HSP 1 Score: 106 bits (264), Expect = 1.310e-26 Identity = 52/57 (91.23%), Postives = 54/57 (94.74%), Query Frame = 1 Query: 1 QEHGRVEYEILLEIITARDVRRAHAFRQQTLEEGADFDELFTGIDNTARKRDFGGTL 171 +EHGRVEYE LLEIITARDVRRA AFRQQT EEGADFDELFTG+DNTARKRDFGGTL Sbjct: 213 KEHGRVEYETLLEIITARDVRRARAFRQQTAEEGADFDELFTGVDNTARKRDFGGTL 269 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74839.17690.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig74839.17690.1 >prot_M-pyrifera_M_contig74839.17690.1 ID=prot_M-pyrifera_M_contig74839.17690.1|Name=mRNA_M-pyrifera_M_contig74839.17690.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=62bp QEHGRVEYEILLEIITARDVRRAHAFRQQTLEEGADFDELFTGIDNTARKback to top mRNA from alignment at M-pyrifera_M_contig74839:659..844+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig74839.17690.1 ID=mRNA_M-pyrifera_M_contig74839.17690.1|Name=mRNA_M-pyrifera_M_contig74839.17690.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=186bp|location=Sequence derived from alignment at M-pyrifera_M_contig74839:659..844+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig74839:659..844+ >mRNA_M-pyrifera_M_contig74839.17690.1 ID=mRNA_M-pyrifera_M_contig74839.17690.1|Name=mRNA_M-pyrifera_M_contig74839.17690.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=372bp|location=Sequence derived from alignment at M-pyrifera_M_contig74839:659..844+ (Macrocystis pyrifera P11B4 male)back to top |