mRNA_M-pyrifera_M_contig74707.17670.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74707.17670.1 vs. uniprot
Match: A0A838WTC5_9CYAN (Uncharacterized protein (Fragment) n=2 Tax=Cylindrospermopsis raciborskii TaxID=77022 RepID=A0A838WTC5_9CYAN) HSP 1 Score: 50.8 bits (120), Expect = 1.710e-5 Identity = 27/41 (65.85%), Postives = 31/41 (75.61%), Query Frame = 1 Query: 1 SGVVSIFSTTQAFAALKKDGSVVAWGHSSYGGSTSSVASEV 123 SGV IFST AFAALK DGSVV WG S+Y G +SSV+S + Sbjct: 3 SGVTQIFSTGNAFAALKSDGSVVTWGDSNYXGDSSSVSSSL 43 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74707.17670.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig74707.17670.1 >prot_M-pyrifera_M_contig74707.17670.1 ID=prot_M-pyrifera_M_contig74707.17670.1|Name=mRNA_M-pyrifera_M_contig74707.17670.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=112bp SGVVSIFSTTQAFAALKKDGSVVAWGHSSYGGSTSSVASEVESGVVSISSback to top mRNA from alignment at M-pyrifera_M_contig74707:722..1057- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig74707.17670.1 ID=mRNA_M-pyrifera_M_contig74707.17670.1|Name=mRNA_M-pyrifera_M_contig74707.17670.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=336bp|location=Sequence derived from alignment at M-pyrifera_M_contig74707:722..1057- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig74707:722..1057- >mRNA_M-pyrifera_M_contig74707.17670.1 ID=mRNA_M-pyrifera_M_contig74707.17670.1|Name=mRNA_M-pyrifera_M_contig74707.17670.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=672bp|location=Sequence derived from alignment at M-pyrifera_M_contig74707:722..1057- (Macrocystis pyrifera P11B4 male)back to top |