prot_M-pyrifera_M_contig74485.17630.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74485.17630.1 vs. uniprot
Match: A0A0H5E532_9BACT (FMN_red domain-containing protein n=1 Tax=Estrella lausannensis TaxID=483423 RepID=A0A0H5E532_9BACT) HSP 1 Score: 52.8 bits (125), Expect = 8.280e-7 Identity = 31/53 (58.49%), Postives = 39/53 (73.58%), Query Frame = 0 Query: 4 KIVAIAGTLRKAAFNKVVLKCAVAAAIAAGAEVEVIDLGEANLPMVNQDLETK 56 KI+A AG+LR +FNK +LK AV A AGAEV +IDL E +LP++NQD E K Sbjct: 6 KILAFAGSLRADSFNKKILKIAVKGAKEAGAEVNLIDLSEYSLPLLNQDEEAK 58
BLAST of mRNA_M-pyrifera_M_contig74485.17630.1 vs. uniprot
Match: A0A501PNQ1_9PROT (NAD(P)H-dependent oxidoreductase n=1 Tax=Emcibacter nanhaiensis TaxID=1505037 RepID=A0A501PNQ1_9PROT) HSP 1 Score: 48.9 bits (115), Expect = 2.160e-5 Identity = 30/52 (57.69%), Postives = 37/52 (71.15%), Query Frame = 0 Query: 3 VKIVAIAGTLRKAAFNKVVLKCAVAAAIAAGAEVEVIDLGEANLPMVNQDLE 54 VKI+A AG++RKA+FNK ++K A A A AGAEV IDL LP+ N DLE Sbjct: 5 VKILAFAGSMRKASFNKSMVKAAAAGAEEAGAEVTYIDLRNYPLPLYNGDLE 56
BLAST of mRNA_M-pyrifera_M_contig74485.17630.1 vs. uniprot
Match: A0A0W1LFZ8_9GAMM (FMN reductase n=6 Tax=Alteromonadales TaxID=135622 RepID=A0A0W1LFZ8_9GAMM) HSP 1 Score: 47.8 bits (112), Expect = 5.680e-5 Identity = 25/53 (47.17%), Postives = 39/53 (73.58%), Query Frame = 0 Query: 4 KIVAIAGTLRKAAFNKVVLKCAVAAAIAAGAEVEVIDLGEANLPMVNQDLETK 56 KI+A+AG+LRK +FN+ ++ A A+ GAEVEVI L E ++P+ N+D+E + Sbjct: 5 KIIALAGSLRKESFNQKLINEAARFALQTGAEVEVIQLNELDIPLFNEDIEAQ 57
BLAST of mRNA_M-pyrifera_M_contig74485.17630.1 vs. uniprot
Match: D2QY73_PIRSD (NADPH-dependent FMN reductase n=1 Tax=Pirellula staleyi (strain ATCC 27377 / DSM 6068 / ICPB 4128) TaxID=530564 RepID=D2QY73_PIRSD) HSP 1 Score: 47.8 bits (112), Expect = 5.930e-5 Identity = 27/50 (54.00%), Postives = 38/50 (76.00%), Query Frame = 0 Query: 5 IVAIAGTLRKAAFNKVVLKCAVAAAIAAGAEVEVIDLGEANLPMVNQDLE 54 I+A AG+LR+ ++NK ++K A A+AAGA VEVIDL E LPM ++D+E Sbjct: 7 ILAFAGSLRRDSYNKKLVKIAAEGAVAAGANVEVIDLTEYPLPMFDEDVE 56 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74485.17630.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig74485.17630.1 ID=prot_M-pyrifera_M_contig74485.17630.1|Name=mRNA_M-pyrifera_M_contig74485.17630.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=57bpback to top |