prot_M-pyrifera_M_contig72625.17255.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig72625.17255.1 vs. uniprot
Match: D7FQW4_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FQW4_ECTSI) HSP 1 Score: 80.5 bits (197), Expect = 2.530e-17 Identity = 34/54 (62.96%), Postives = 41/54 (75.93%), Query Frame = 0 Query: 1 SQYISRSDFLGCGGRLGWPKLSCDELRDSDRENFPCLWRAGRMFKDTVAHSLPT 54 +QY+SR+D LGCGG+LGWPKL +LRD +RENF +WR GR FK TV SL T Sbjct: 144 AQYVSRTDILGCGGKLGWPKLDDYKLRDCERENFGFIWRTGRTFKHTVQESLET 197 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig72625.17255.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig72625.17255.1 ID=prot_M-pyrifera_M_contig72625.17255.1|Name=mRNA_M-pyrifera_M_contig72625.17255.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=54bpback to top |