prot_M-pyrifera_M_contig72503.17234.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig72503.17234.1 vs. uniprot
Match: D7FM89_ECTSI (Flagellar outer arm dynein 14 kDa light chain LC5 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FM89_ECTSI) HSP 1 Score: 97.4 bits (241), Expect = 6.580e-25 Identity = 41/53 (77.36%), Postives = 50/53 (94.34%), Query Frame = 0 Query: 1 VGSPDELDKLTADNKDKLIVVDYSTTWCGPCKMVLPKFEELASEYTDAIFIKV 53 +GS ELDKLT+DNKDKL+VVDYSTTWCGPCKM+LPKFE+LA +Y+DA+F+KV Sbjct: 20 IGSFAELDKLTSDNKDKLVVVDYSTTWCGPCKMILPKFEKLAEQYSDAVFVKV 72
BLAST of mRNA_M-pyrifera_M_contig72503.17234.1 vs. uniprot
Match: A0A6H5K2L8_9PHAE (Thioredoxin domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K2L8_9PHAE) HSP 1 Score: 97.4 bits (241), Expect = 1.880e-24 Identity = 41/53 (77.36%), Postives = 50/53 (94.34%), Query Frame = 0 Query: 1 VGSPDELDKLTADNKDKLIVVDYSTTWCGPCKMVLPKFEELASEYTDAIFIKV 53 +GS ELDKLT+DNKDKL+VVDYSTTWCGPCKM+LPKFE+LA +Y+DA+F+KV Sbjct: 59 IGSFAELDKLTSDNKDKLVVVDYSTTWCGPCKMILPKFEKLAEQYSDAVFVKV 111
BLAST of mRNA_M-pyrifera_M_contig72503.17234.1 vs. uniprot
Match: A0A8K0ED01_BRALA (TXN protein n=1 Tax=Branchiostoma lanceolatum TaxID=7740 RepID=A0A8K0ED01_BRALA) HSP 1 Score: 77.0 bits (188), Expect = 4.600e-17 Identity = 32/48 (66.67%), Postives = 40/48 (83.33%), Query Frame = 0 Query: 6 ELDKLTADNKDKLIVVDYSTTWCGPCKMVLPKFEELASEYTDAIFIKV 53 E D L ADNKDKLIVVD++ +WCGPCKM+ P FE+LA E++D IF+KV Sbjct: 10 EFDALVADNKDKLIVVDFTASWCGPCKMIGPVFEKLAEEHSDVIFVKV 57
BLAST of mRNA_M-pyrifera_M_contig72503.17234.1 vs. uniprot
Match: C3YTF6_BRAFL (Thioredoxin n=1 Tax=Branchiostoma floridae TaxID=7739 RepID=C3YTF6_BRAFL) HSP 1 Score: 75.5 bits (184), Expect = 1.820e-16 Identity = 31/48 (64.58%), Postives = 39/48 (81.25%), Query Frame = 0 Query: 6 ELDKLTADNKDKLIVVDYSTTWCGPCKMVLPKFEELASEYTDAIFIKV 53 + D L ADNKDKLIVVD++ +WCGPCKM+ P FE+LA + TD IF+KV Sbjct: 9 DFDALLADNKDKLIVVDFTASWCGPCKMIAPVFEKLAEDNTDVIFVKV 56
BLAST of mRNA_M-pyrifera_M_contig72503.17234.1 vs. uniprot
Match: A0A4D9DEX6_9STRA (Thioredoxin domain-containing protein n=3 Tax=Monodopsidaceae TaxID=425072 RepID=A0A4D9DEX6_9STRA) HSP 1 Score: 75.5 bits (184), Expect = 5.380e-16 Identity = 31/51 (60.78%), Postives = 42/51 (82.35%), Query Frame = 0 Query: 3 SPDELDKLTADNKDKLIVVDYSTTWCGPCKMVLPKFEELASEYTDAIFIKV 53 SPD+ DKL +KL++VDYSTTWCGPCKM+ PKF+E++S + DA+F+KV Sbjct: 48 SPDDFDKLVTGAGEKLLIVDYSTTWCGPCKMMAPKFDEMSSRF-DAVFVKV 97
BLAST of mRNA_M-pyrifera_M_contig72503.17234.1 vs. uniprot
Match: A0A7S1ZG46_TRICV (Hypothetical protein n=1 Tax=Trieres chinensis TaxID=1514140 RepID=A0A7S1ZG46_TRICV) HSP 1 Score: 75.5 bits (184), Expect = 5.770e-16 Identity = 30/53 (56.60%), Postives = 39/53 (73.58%), Query Frame = 0 Query: 1 VGSPDELDKLTADNKDKLIVVDYSTTWCGPCKMVLPKFEELASEYTDAIFIKV 53 + SPD D D L+VVDYSTTWCGPCK++ PKFEE + +Y+DA+F+KV Sbjct: 47 IDSPDAFDNTIKSAGDALVVVDYSTTWCGPCKVIAPKFEEFSEKYSDAVFLKV 99
BLAST of mRNA_M-pyrifera_M_contig72503.17234.1 vs. uniprot
Match: A0A6U0KDA1_9STRA (Hypothetical protein n=1 Tax=Minutocellus polymorphus TaxID=265543 RepID=A0A6U0KDA1_9STRA) HSP 1 Score: 75.1 bits (183), Expect = 8.350e-16 Identity = 30/53 (56.60%), Postives = 39/53 (73.58%), Query Frame = 0 Query: 1 VGSPDELDKLTADNKDKLIVVDYSTTWCGPCKMVLPKFEELASEYTDAIFIKV 53 + SPD DK L+VVDYSTTWCGPCK++ PKF+EL+ +Y DA+F+KV Sbjct: 48 IDSPDAFDKTIESAGGALVVVDYSTTWCGPCKVIAPKFDELSDQYADAVFLKV 100
BLAST of mRNA_M-pyrifera_M_contig72503.17234.1 vs. uniprot
Match: A0A6P5AJL9_BRABE (Thioredoxin n=3 Tax=Branchiostoma TaxID=7737 RepID=A0A6P5AJL9_BRABE) HSP 1 Score: 73.2 bits (178), Expect = 1.520e-15 Identity = 30/48 (62.50%), Postives = 38/48 (79.17%), Query Frame = 0 Query: 6 ELDKLTADNKDKLIVVDYSTTWCGPCKMVLPKFEELASEYTDAIFIKV 53 + D L ADNKDKLIVVD++ +WCGPC+M+ P FE+LA E D IF+KV Sbjct: 10 DFDALLADNKDKLIVVDFTASWCGPCRMIAPVFEKLAEENPDVIFVKV 57
BLAST of mRNA_M-pyrifera_M_contig72503.17234.1 vs. uniprot
Match: A0A6V2AAC3_9STRA (Hypothetical protein n=1 Tax=Ditylum brightwellii TaxID=49249 RepID=A0A6V2AAC3_9STRA) HSP 1 Score: 73.6 bits (179), Expect = 1.690e-15 Identity = 29/53 (54.72%), Postives = 40/53 (75.47%), Query Frame = 0 Query: 1 VGSPDELDKLTADNKDKLIVVDYSTTWCGPCKMVLPKFEELASEYTDAIFIKV 53 + S + DK D L+VVDYSTTWCGPCK++ PKF+EL+ +Y+DA+F+KV Sbjct: 48 IDSEAKFDKTIESAGDSLVVVDYSTTWCGPCKVIAPKFDELSEQYSDAVFVKV 100
BLAST of mRNA_M-pyrifera_M_contig72503.17234.1 vs. uniprot
Match: B8BVB7_THAPS (Thioredoxin f n=1 Tax=Thalassiosira pseudonana TaxID=35128 RepID=B8BVB7_THAPS) HSP 1 Score: 73.9 bits (180), Expect = 1.970e-15 Identity = 30/53 (56.60%), Postives = 40/53 (75.47%), Query Frame = 0 Query: 1 VGSPDELDKLTADNKDKLIVVDYSTTWCGPCKMVLPKFEELASEYTDAIFIKV 53 V S E D + DKL+V+DYSTTWCGPCK++ PKF+EL+ +Y D++FIKV Sbjct: 41 VNSEAEFDAKVSGAGDKLVVIDYSTTWCGPCKVIAPKFDELSDQYPDSVFIKV 93 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig72503.17234.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig72503.17234.1 ID=prot_M-pyrifera_M_contig72503.17234.1|Name=mRNA_M-pyrifera_M_contig72503.17234.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=53bpback to top |