prot_M-pyrifera_M_contig72309.17193.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig72309.17193.1 vs. uniprot
Match: A0A6B1AYI3_9ACTN (SAF domain-containing protein n=1 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A6B1AYI3_9ACTN) HSP 1 Score: 85.1 bits (209), Expect = 1.080e-17 Identity = 51/114 (44.74%), Postives = 65/114 (57.02%), Query Frame = 0 Query: 32 SVDRLRREWQPIAPSWVITRPLEAGHVVEPGDVEARTLPPAALPSDAVEGSPVGRRLADSVATGEIVRNGRLDVAGATANASRIGDRRGALTLPSPTPHLEPGDRVDLYALLDG 145 S R +WQ WV+T LEAG + D+ + LP A P DA G P G L DS+ATGEIVR+GRL A A A+++G+ G LT+ + L GD VDLY L+DG Sbjct: 51 SAATARAQWQTEIDGWVVTGDLEAGTTLTADDLASTRLPAAGTPHDATTGDPNGFTLRDSMATGEIVRDGRLTTA-AGPLAAQLGEAAGGLTIATDGTPLGAGDLVDLYGLIDG 163 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig72309.17193.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig72309.17193.1 ID=prot_M-pyrifera_M_contig72309.17193.1|Name=mRNA_M-pyrifera_M_contig72309.17193.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=145bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|