prot_M-pyrifera_M_contig716.17066.1 (polypeptide) Macrocystis pyrifera P11B4 male
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig716.17066.1 vs. uniprot
Match: A0A6H5JM75_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JM75_9PHAE) HSP 1 Score: 58.2 bits (139), Expect = 4.880e-6 Identity = 32/94 (34.04%), Postives = 47/94 (50.00%), Query Frame = 0 Query: 1 YVFVAGVSKAWRNAWGNLPKITQAITVETTAAPLQWSFDGGLMNRESLSRRIAETCGVKVWRCAY-LNGCRFPESACFTAVARGELETIQWALS 93 Y+F AGVS+ WR+AW P T+A T +T L SF GL R ++ R IA + + A + C + E C A G + ++WA + Sbjct: 23 YIFFAGVSRTWRDAWEGRPTTTRAFTADTGVPQLSQSFKCGLAPRSTVCRDIAALGRLDLLVSAREQHECPWDEETCSCASENGHADVLRWAFA 116
BLAST of mRNA_M-pyrifera_M_contig716.17066.1 vs. uniprot
Match: D7G8W5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G8W5_ECTSI) HSP 1 Score: 57.8 bits (138), Expect = 8.740e-6 Identity = 31/94 (32.98%), Postives = 48/94 (51.06%), Query Frame = 0 Query: 1 YVFVAGVSKAWRNAWGNLPKITQAITVETTAAPLQWSFDGGLMNRESLSRRIAETCGVKVWRCAYLN-GCRFPESACFTAVARGELETIQWALS 93 Y+F AGVS+ WR+AW P T+A+T +T L SF+ GL R ++ + IA + + A C + E C A G + ++WA + Sbjct: 9 YLFFAGVSRTWRDAWEGRPTTTRAVTADTGVPQLSQSFECGLARRSTVCQDIAALGRLDLLVSAREEYECPWDEDTCSYASENGHADVLRWAFA 102
BLAST of mRNA_M-pyrifera_M_contig716.17066.1 vs. uniprot
Match: D7G8V2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G8V2_ECTSI) HSP 1 Score: 58.5 bits (140), Expect = 1.030e-5 Identity = 27/76 (35.53%), Postives = 43/76 (56.58%), Query Frame = 0 Query: 1 YVFVAGVSKAWRNAWGNLPKITQAITVETTAAPLQWSFDGGLMNRESLSRRIAETCGVKVWRCAYLNGCRFPESAC 76 ++F AGV +AW+ AWG P T+A+T +TT A L +F GL + +A+ + + +CA +GC + E C Sbjct: 24 FLFFAGVCRAWKEAWGQRPPTTRAVTEDTTVAQLSQNFQCGLSLIADVCTSVAKLGRLDLLQCARRHGCAWNEVTC 99 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig716.17066.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig716.17066.1 ID=prot_M-pyrifera_M_contig716.17066.1|Name=mRNA_M-pyrifera_M_contig716.17066.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=396bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|