prot_M-pyrifera_M_contig100724.161.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig100724.161.1 vs. uniprot
Match: A0A6A6VBQ6_9PLEO (Ankyrin n=1 Tax=Sporormia fimetaria CBS 119925 TaxID=1340428 RepID=A0A6A6VBQ6_9PLEO) HSP 1 Score: 51.6 bits (122), Expect = 2.980e-5 Identity = 32/94 (34.04%), Postives = 54/94 (57.45%), Query Frame = 0 Query: 16 EEQLTARDNQGNTPLISAAAEGSTEAARMLLEYLPCESLNMENKAGVNAFIRACK-GEHSVFVRLLATRLPQGELCKCDDAGNTAIHAMATAGE 108 + + +++N TPL+ AA G + + ML + P S++++NKAG++A + ACK G ++ + L L D+AGNTA+H + AGE Sbjct: 65 DSEFISQNNDCETPLMLAATSGREDMSVMLAKRFP-SSISLQNKAGLDALMIACKSGIGTLHLIPTLLNLHPSLLHAHDNAGNTALHHASAAGE 157 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig100724.161.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig100724.161.1 ID=prot_M-pyrifera_M_contig100724.161.1|Name=mRNA_M-pyrifera_M_contig100724.161.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=116bpback to top |