prot_M-pyrifera_M_contig104928.1054.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104928.1054.1 vs. uniprot
Match: A0A3M0XV22_9PROT (Phenylacetate--CoA ligase family protein n=1 Tax=Alphaproteobacteria bacterium TaxID=1913988 RepID=A0A3M0XV22_9PROT) HSP 1 Score: 49.7 bits (117), Expect = 2.420e-5 Identity = 27/52 (51.92%), Postives = 32/52 (61.54%), Query Frame = 0 Query: 9 SAVKGIAWPAIPPPAQAAIFALCAQLDVSQWWPADKIAAMQLAQADTLLQHA 60 S + GIAWPAIP A + A+ QL+ SQWW D +AA QL Q LL HA Sbjct: 17 SRMPGIAWPAIPDGRAATLLAIQFQLEQSQWWSPDDLAAWQLRQLRLLLAHA 68 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104928.1054.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig104928.1054.1 ID=prot_M-pyrifera_M_contig104928.1054.1|Name=mRNA_M-pyrifera_M_contig104928.1054.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=63bpback to top |