mRNA_M-pyrifera_M_contig104928.1054.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104928.1054.1 vs. uniprot
Match: A0A3M0XV22_9PROT (Phenylacetate--CoA ligase family protein n=1 Tax=Alphaproteobacteria bacterium TaxID=1913988 RepID=A0A3M0XV22_9PROT) HSP 1 Score: 49.7 bits (117), Expect = 2.420e-5 Identity = 27/52 (51.92%), Postives = 32/52 (61.54%), Query Frame = 1 Query: 25 SAVKGIAWPAIPPPAQAAIFALCAQLDVSQWWPADKIAAMQLAQADTLLQHA 180 S + GIAWPAIP A + A+ QL+ SQWW D +AA QL Q LL HA Sbjct: 17 SRMPGIAWPAIPDGRAATLLAIQFQLEQSQWWSPDDLAAWQLRQLRLLLAHA 68 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104928.1054.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig104928.1054.1 >prot_M-pyrifera_M_contig104928.1054.1 ID=prot_M-pyrifera_M_contig104928.1054.1|Name=mRNA_M-pyrifera_M_contig104928.1054.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=63bp MLPAAEFPSAVKGIAWPAIPPPAQAAIFALCAQLDVSQWWPADKIAAMQLback to top mRNA from alignment at M-pyrifera_M_contig104928:451..639+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig104928.1054.1 ID=mRNA_M-pyrifera_M_contig104928.1054.1|Name=mRNA_M-pyrifera_M_contig104928.1054.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=189bp|location=Sequence derived from alignment at M-pyrifera_M_contig104928:451..639+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig104928:451..639+ >mRNA_M-pyrifera_M_contig104928.1054.1 ID=mRNA_M-pyrifera_M_contig104928.1054.1|Name=mRNA_M-pyrifera_M_contig104928.1054.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=378bp|location=Sequence derived from alignment at M-pyrifera_M_contig104928:451..639+ (Macrocystis pyrifera P11B4 male)back to top |