mRNA_M-pyrifera_M_contig104043.860.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104043.860.1 vs. uniprot
Match: UPI00055E8A3C (GNAT family N-acetyltransferase n=1 Tax=Streptomyces yeochonensis TaxID=89050 RepID=UPI00055E8A3C) HSP 1 Score: 50.1 bits (118), Expect = 3.700e-5 Identity = 34/96 (35.42%), Postives = 47/96 (48.96%), Query Frame = 1 Query: 1 MICLATPRLLLRTWRVED---------GPDLLRLVPGDAPTDGQLLFNSSACSVLGADEPAASGLERFERSWATDGFGIFALESFESGSLIGLAGV 261 M + TPRL+LR WR ED P+++R + GD SV E A +ER ER W T+GFG+FA+E ++G G G+ Sbjct: 1 MTTIETPRLVLRRWREEDVEPYAAVNADPEVMRWI-GDG-------------SVRDTAETRAH-IERIERLWETEGFGLFAVELRDTGEFAGFTGL 81
BLAST of mRNA_M-pyrifera_M_contig104043.860.1 vs. uniprot
Match: A0A1G7GUX7_9RHOB (Protein N-acetyltransferase, RimJ/RimL family n=1 Tax=Celeribacter baekdonensis TaxID=875171 RepID=A0A1G7GUX7_9RHOB) HSP 1 Score: 49.3 bits (116), Expect = 6.400e-5 Identity = 32/82 (39.02%), Postives = 44/82 (53.66%), Query Frame = 1 Query: 16 TPRLLLRTWRVEDGPDLLRLVPGDAPTDGQLLFNSSACSVLGADEPAASGLERFERSWATDGFGIFALESFESGSLIGLAGV 261 T RLLLR W+ ED + GD P + + N S + + AA + FER W GFG+FA+ES ++G LIG G+ Sbjct: 8 TERLLLRGWKPEDHAPFAAMC-GD-PEVMRYIGNGSTRTP----DDAARYIGSFEREWTERGFGLFAVESKQTGGLIGFTGL 83 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104043.860.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig104043.860.1 >prot_M-pyrifera_M_contig104043.860.1 ID=prot_M-pyrifera_M_contig104043.860.1|Name=mRNA_M-pyrifera_M_contig104043.860.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=102bp MICLATPRLLLRTWRVEDGPDLLRLVPGDAPTDGQLLFNSSACSVLGADEback to top mRNA from alignment at M-pyrifera_M_contig104043:55..360- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig104043.860.1 ID=mRNA_M-pyrifera_M_contig104043.860.1|Name=mRNA_M-pyrifera_M_contig104043.860.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=306bp|location=Sequence derived from alignment at M-pyrifera_M_contig104043:55..360- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig104043:55..360- >mRNA_M-pyrifera_M_contig104043.860.1 ID=mRNA_M-pyrifera_M_contig104043.860.1|Name=mRNA_M-pyrifera_M_contig104043.860.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=612bp|location=Sequence derived from alignment at M-pyrifera_M_contig104043:55..360- (Macrocystis pyrifera P11B4 male)back to top |