mRNA_M-pyrifera_M_contig10401.856.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig10401.856.1 vs. uniprot
Match: D8LSF0_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LSF0_ECTSI) HSP 1 Score: 68.9 bits (167), Expect = 2.570e-11 Identity = 33/44 (75.00%), Postives = 39/44 (88.64%), Query Frame = 1 Query: 217 MKLPITNNDLVEHMQKHGMVKTPAIMEAFRAVDRGDFATALLRQ 348 MKLP +N++LV +M+KHGMVKTPAI+EAFRAVDRGDFAT L Q Sbjct: 1 MKLPRSNDELVAYMKKHGMVKTPAIIEAFRAVDRGDFATPNLGQ 44 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig10401.856.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig10401.856.1 >prot_M-pyrifera_M_contig10401.856.1 ID=prot_M-pyrifera_M_contig10401.856.1|Name=mRNA_M-pyrifera_M_contig10401.856.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=44bp MKLPITNNDLVEHMQKHGMVKTPAIMEAFRAVDRGDFATALLRQback to top mRNA from alignment at M-pyrifera_M_contig10401:9163..9510+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig10401.856.1 ID=mRNA_M-pyrifera_M_contig10401.856.1|Name=mRNA_M-pyrifera_M_contig10401.856.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=348bp|location=Sequence derived from alignment at M-pyrifera_M_contig10401:9163..9510+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig10401:9163..9510+ >mRNA_M-pyrifera_M_contig10401.856.1 ID=mRNA_M-pyrifera_M_contig10401.856.1|Name=mRNA_M-pyrifera_M_contig10401.856.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=264bp|location=Sequence derived from alignment at M-pyrifera_M_contig10401:9163..9510+ (Macrocystis pyrifera P11B4 male)back to top |