prot_M-pyrifera_M_contig103605.765.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig103605.765.1 vs. uniprot
Match: A0A7S2XXS1_9STRA (Hypothetical protein (Fragment) n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2XXS1_9STRA) HSP 1 Score: 66.2 bits (160), Expect = 1.550e-10 Identity = 29/120 (24.17%), Postives = 61/120 (50.83%), Query Frame = 0 Query: 23 DLLRYFQFSYKQSSGYKGVGHFKLSGADDGGEEVEFCVACDPEEGVQCHYGEPRDSERPSFTVVMTVNDFLRVYSGQVCSSELMRMGVSGRIWVNGFAIRAVQQFATSFCYESGTWEAFY 142 DL+++F F++ +S ++G F + +A + C + + + S+ + +FL +YSGQ ++E++RMG++G++ + F + ++QFA F + W+ FY Sbjct: 19 DLMQFFCFAWNVNSSFRGTVQFSFPDTISSYDGKPLQLAVQVSDSGTCVFRDTPPDKEVSYEIKAPAREFLHIYSGQASATEMVRMGLTGKLQMRPFNVMQMRQFANCFDFSQEKWDEFY 138 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig103605.765.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig103605.765.1 ID=prot_M-pyrifera_M_contig103605.765.1|Name=mRNA_M-pyrifera_M_contig103605.765.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=162bpback to top |