mRNA_M-pyrifera_M_contig103437.736.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig103437.736.1 vs. uniprot
Match: UPI001D08D851 (trafficking protein particle complex subunit 3 n=2 Tax=Coccinellini TaxID=263631 RepID=UPI001D08D851) HSP 1 Score: 49.7 bits (117), Expect = 5.180e-5 Identity = 32/84 (38.10%), Postives = 44/84 (52.38%), Query Frame = 1 Query: 13 ELLQLTFGAIAARIVREAEGVDSANAQLRALGASMGGRLADDFFASRAAAAALPRCSTFRDAMQSLASYALPQYLGVAGAVGRW 264 EL+ LT+GA+ A++V++AE D QL LG +MG RL +DF A RC +D + S A YLG+ V W Sbjct: 16 ELVTLTYGALVAQMVKDAENTDDVGKQLERLGYNMGVRLIEDFLAKTGTG----RCIDLKDTADKIQS-AFKMYLGLQPNVANW 94 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig103437.736.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig103437.736.1 >prot_M-pyrifera_M_contig103437.736.1 ID=prot_M-pyrifera_M_contig103437.736.1|Name=mRNA_M-pyrifera_M_contig103437.736.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=104bp LQSLELLQLTFGAIAARIVREAEGVDSANAQLRALGASMGGRLADDFFASback to top mRNA from alignment at M-pyrifera_M_contig103437:1..360- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig103437.736.1 ID=mRNA_M-pyrifera_M_contig103437.736.1|Name=mRNA_M-pyrifera_M_contig103437.736.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=360bp|location=Sequence derived from alignment at M-pyrifera_M_contig103437:1..360- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig103437:1..360- >mRNA_M-pyrifera_M_contig103437.736.1 ID=mRNA_M-pyrifera_M_contig103437.736.1|Name=mRNA_M-pyrifera_M_contig103437.736.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=624bp|location=Sequence derived from alignment at M-pyrifera_M_contig103437:1..360- (Macrocystis pyrifera P11B4 male)back to top |