prot_M-pyrifera_M_contig100236.58.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig100236.58.1 vs. uniprot
Match: A0A350UZ90_9BACT (Por_Secre_tail domain-containing protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A350UZ90_9BACT) HSP 1 Score: 53.5 bits (127), Expect = 5.700e-5 Identity = 26/92 (28.26%), Postives = 48/92 (52.17%), Query Frame = 0 Query: 1 VHVFWSAPEQVQGFEVFHARSTDGGTTFGPAVAVPGARFDQLYDVDVQGAVLAMAWAVIDPQTQTIQVERTSSSDGGQTWAPVTKLPQATGV 92 VH+ W+ Q +++++ RSTDGG ++ P VA+ + G+V+ + WA D + T ++ +S+ GG +W T+L A + Sbjct: 108 VHIIWTQSPSSQHYDIYYRRSTDGGGSWLPPVAIYTGGKSLYQSITASGSVVIVTWAE-DLPSNTSEIYVRNSTTGGNSWGSATRLTNANSI 198 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig100236.58.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig100236.58.1 ID=prot_M-pyrifera_M_contig100236.58.1|Name=mRNA_M-pyrifera_M_contig100236.58.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=193bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|