prot_M-pyrifera_M_contig100229.55.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig100229.55.1 vs. uniprot
Match: A0A433TMW2_ELYCH (Uncharacterized protein n=1 Tax=Elysia chlorotica TaxID=188477 RepID=A0A433TMW2_ELYCH) HSP 1 Score: 60.5 bits (145), Expect = 1.250e-9 Identity = 30/59 (50.85%), Postives = 43/59 (72.88%), Query Frame = 0 Query: 5 ELRWAISQLELGLKREDCDREQAREARRVLIVLRNPEARLIKKRFTLKNTFGDVKAAMR 63 ELRW ISQLELGL+R+D D QA E ++L +LR+P+A L+KKR +++ GD + M+ Sbjct: 16 ELRWCISQLELGLQRQDPDSRQAMETIKILKILRSPKAPLVKKRQAMRSALGDYRKKMK 74
BLAST of mRNA_M-pyrifera_M_contig100229.55.1 vs. uniprot
Match: UPI000719CEDE (UPF0488 protein C8orf33 homolog n=1 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719CEDE) HSP 1 Score: 57.4 bits (137), Expect = 1.770e-8 Identity = 30/60 (50.00%), Postives = 42/60 (70.00%), Query Frame = 0 Query: 3 EAELRWAISQLELGLKREDCDREQAREARRVLIVLRNPEARLIKKRFTLKNTFGDVKAAM 62 E EL W I QLELGL R+ D +QARE +R+L +L +P+A L+KKR +++TF D + M Sbjct: 13 ERELIWCIEQLELGLSRQKPDSKQAREGKRILKMLSDPKAPLVKKRQAMRSTFCDYRKKM 72 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig100229.55.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig100229.55.1 ID=prot_M-pyrifera_M_contig100229.55.1|Name=mRNA_M-pyrifera_M_contig100229.55.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=64bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|