prot_M-pyrifera_M_contig99753.22928.1 (polypeptide) Macrocystis pyrifera P11B4 male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99753.22928.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90)
Total hits: 20
ZOOM
x 1
POSITION
0
MALSRPVLPLRLWGSYVRSLEERPLRTKAATSAVLLALQECIVQVIRKRPDLLRTLKLALYGCLVSGPMGHVLYSSIASATSGLPGALNGIAQLLLV102030405060708090Expect = 2.79e-10 / Id = 39.81Expect = 5.91e-10 / Id = 41.38Expect = 2.87e-7 / Id = 37.93Expect = 3.61e-7 / Id = 39.08Expect = 7.19e-7 / Id = 37.93Expect = 8.85e-7 / Id = 37.00Expect = 2.90e-6 / Id = 37.50Expect = 3.01e-6 / Id = 39.77Expect = 3.42e-6 / Id = 43.06Expect = 3.54e-6 / Id = 40.40SequenceA0A1Y2HK19_9FUNGA0A4P9YAQ4_9FUNGA0A2T6ZME6_TUBBOA0A5J5FBV7_9PEZID5GLC4_TUBMMA0A4Y7QLR9_9AGAMA0A4S2MVJ0_9PEZIA0A6A6HMV1_9PEZIA0A2P6TD78_CHLSOA0A8C5PIA9_9ANUR
Match NameE-valueIdentityDescription
A0A1Y2HK19_9FUNG2.790e-1039.81Uncharacterized protein n=1 Tax=Catenaria anguillu... [more]
A0A4P9YAQ4_9FUNG5.910e-1041.38Uncharacterized protein n=1 Tax=Piptocephalis cyli... [more]
A0A2T6ZME6_TUBBO2.870e-737.93Uncharacterized protein n=1 Tax=Tuber borchii TaxI... [more]
A0A5J5FBV7_9PEZI3.610e-739.08Uncharacterized protein n=1 Tax=Sphaerosporella br... [more]
D5GLC4_TUBMM7.190e-737.93Uncharacterized protein n=3 Tax=Tuberaceae TaxID=4... [more]
A0A4Y7QLR9_9AGAM8.850e-737.00Uncharacterized protein n=1 Tax=Rickenella mellea ... [more]
A0A4S2MVJ0_9PEZI2.900e-637.50Uncharacterized protein n=1 Tax=Ascodesmis nigrica... [more]
A0A6A6HMV1_9PEZI3.010e-639.77Integral membrane protein 25D9-6 n=1 Tax=Viridothe... [more]
A0A2P6TD78_CHLSO3.420e-643.06Peroxisomal membrane PMP22 n=1 Tax=Chlorella sorok... [more]
A0A8C5PIA9_9ANUR3.540e-640.40Peroxisomal membrane protein 2 n=1 Tax=Leptobrachi... [more]

Pages

back to top