Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR023393 | START-like domain superfamily | GENE3D | 3.30.530.20 | | coord: 13..109 e-value: 4.0E-13 score: 51.8 |
IPR019587 | Polyketide cyclase/dehydrase | PFAM | PF10604 | Polyketide_cyc2 | coord: 14..104 e-value: 8.0E-10 score: 39.2 |
None | No IPR available | SUPERFAMILY | 55961 | Bet v1-like | coord: 16..105 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig99300.22846.1 ID=prot_M-pyrifera_M_contig99300.22846.1|Name=mRNA_M-pyrifera_M_contig99300.22846.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=109bp MAEGASSGPKFVSSKRTAFINAPADDVWAVISPFDLSALNPDLVVKFENG PASNVGSRRTLRLPPASDFVETLLSLDNFAQSFSYTITHPAITKHRGMWT VTPINLGDK back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR023393 | START-like_dom_sf |
IPR019587 | Polyketide_cyclase/dehydratase |
|