prot_M-pyrifera_M_contig98985.22770.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig98985.22770.1 vs. uniprot
Match: A0A7S3ABX9_9EUKA (Hypothetical protein (Fragment) n=1 Tax=Haptolina ericina TaxID=156174 RepID=A0A7S3ABX9_9EUKA) HSP 1 Score: 59.3 bits (142), Expect = 4.790e-9 Identity = 31/64 (48.44%), Postives = 41/64 (64.06%), Query Frame = 0 Query: 1 MSNDVDDVLAVGMAFAMEQNGEVDILGIVHDVGLPLGVCGISVLTEYYGRSADVLIGGYKGDFG 64 MS DVDDV A+ A AM GE D+L +VH G P G+ SV+ E+YG ++ V +G YKG +G Sbjct: 1 MSFDVDDVGAICAAHAMMDQGEADLLAVVHSSGYPQGIAMASVINEWYGHTS-VRLGAYKGQYG 63
BLAST of mRNA_M-pyrifera_M_contig98985.22770.1 vs. uniprot
Match: A0A4V1U4T2_9BACT (IU_nuc_hydro domain-containing protein (Fragment) n=1 Tax=Cytophagaceae bacterium TaxID=2026729 RepID=A0A4V1U4T2_9BACT) HSP 1 Score: 52.8 bits (125), Expect = 2.060e-6 Identity = 29/63 (46.03%), Postives = 38/63 (60.32%), Query Frame = 0 Query: 1 MSNDVDDVLAVGMAFAMEQNGEVDILGIVHDVGLPLGVCGISVLTEYYGRSADVLIGGYKGDF 63 M+ DVDD A+GM A+ NGE +IL I+H+ G V I + YYGR ++ IG YKG F Sbjct: 200 MALDVDDAGALGMLHALADNGEANILAIMHNTGTAKSVGIIDAINTYYGRP-NIPIGAYKGSF 261 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig98985.22770.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig98985.22770.1 ID=prot_M-pyrifera_M_contig98985.22770.1|Name=mRNA_M-pyrifera_M_contig98985.22770.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=64bpback to top |