prot_M-pyrifera_M_contig98939.22756.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig98939.22756.1 vs. uniprot
Match: D7FLR7_ECTSI (Histone hairpin binding protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FLR7_ECTSI) HSP 1 Score: 69.3 bits (168), Expect = 1.050e-12 Identity = 33/38 (86.84%), Postives = 36/38 (94.74%), Query Frame = 0 Query: 1 LKFASDREEDPHRIAQRQKQIDYGKNTTGYDRYKSQVP 38 LKFASDREEDPHRIAQRQKQID+GKNT+GYDRY + VP Sbjct: 911 LKFASDREEDPHRIAQRQKQIDFGKNTSGYDRYLAAVP 948
BLAST of mRNA_M-pyrifera_M_contig98939.22756.1 vs. uniprot
Match: A0A662XJP5_9STRA (SLBP_RNA_bind domain-containing protein n=1 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662XJP5_9STRA) HSP 1 Score: 58.9 bits (141), Expect = 5.880e-10 Identity = 27/36 (75.00%), Postives = 31/36 (86.11%), Query Frame = 0 Query: 3 FASDREEDPHRIAQRQKQIDYGKNTTGYDRYKSQVP 38 A ++E DPHR+AQRQKQIDYGKNT GYDRY +QVP Sbjct: 92 LADEKETDPHRLAQRQKQIDYGKNTLGYDRYCAQVP 127
BLAST of mRNA_M-pyrifera_M_contig98939.22756.1 vs. uniprot
Match: A0A421FLB8_9STRA (SLBP_RNA_bind domain-containing protein n=2 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A421FLB8_9STRA) HSP 1 Score: 58.9 bits (141), Expect = 1.120e-9 Identity = 27/36 (75.00%), Postives = 31/36 (86.11%), Query Frame = 0 Query: 3 FASDREEDPHRIAQRQKQIDYGKNTTGYDRYKSQVP 38 A ++E DPHR+AQRQKQIDYGKNT GYDRY +QVP Sbjct: 29 LADEKEADPHRLAQRQKQIDYGKNTIGYDRYCAQVP 64
BLAST of mRNA_M-pyrifera_M_contig98939.22756.1 vs. uniprot
Match: G5A233_PHYSP (SLBP_RNA_bind domain-containing protein n=1 Tax=Phytophthora sojae (strain P6497) TaxID=1094619 RepID=G5A233_PHYSP) HSP 1 Score: 58.9 bits (141), Expect = 2.180e-9 Identity = 27/36 (75.00%), Postives = 31/36 (86.11%), Query Frame = 0 Query: 3 FASDREEDPHRIAQRQKQIDYGKNTTGYDRYKSQVP 38 A ++E DPHR+AQRQKQIDYGKNT GYDRY +QVP Sbjct: 47 LADEKETDPHRLAQRQKQIDYGKNTIGYDRYCAQVP 82
BLAST of mRNA_M-pyrifera_M_contig98939.22756.1 vs. uniprot
Match: A0A8K1CNZ8_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1CNZ8_PYTOL) HSP 1 Score: 58.5 bits (140), Expect = 2.830e-9 Identity = 27/34 (79.41%), Postives = 31/34 (91.18%), Query Frame = 0 Query: 5 SDREEDPHRIAQRQKQIDYGKNTTGYDRYKSQVP 38 ++RE DPHR+AQRQKQIDYGKNT GYDRY +QVP Sbjct: 45 TERETDPHRLAQRQKQIDYGKNTLGYDRYCAQVP 78
BLAST of mRNA_M-pyrifera_M_contig98939.22756.1 vs. uniprot
Match: W2JZB1_PHYPR (SLBP_RNA_bind domain-containing protein n=8 Tax=Phytophthora TaxID=4783 RepID=W2JZB1_PHYPR) HSP 1 Score: 58.9 bits (141), Expect = 2.970e-9 Identity = 27/36 (75.00%), Postives = 31/36 (86.11%), Query Frame = 0 Query: 3 FASDREEDPHRIAQRQKQIDYGKNTTGYDRYKSQVP 38 A ++E DPHR+AQRQKQIDYGKNT GYDRY +QVP Sbjct: 80 LADEKETDPHRLAQRQKQIDYGKNTIGYDRYCAQVP 115
BLAST of mRNA_M-pyrifera_M_contig98939.22756.1 vs. uniprot
Match: A0A225WRR9_9STRA (SLBP_RNA_bind domain-containing protein n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225WRR9_9STRA) HSP 1 Score: 57.8 bits (138), Expect = 6.000e-9 Identity = 27/36 (75.00%), Postives = 30/36 (83.33%), Query Frame = 0 Query: 3 FASDREEDPHRIAQRQKQIDYGKNTTGYDRYKSQVP 38 A +E DPHR+AQRQKQIDYGKNT GYDRY +QVP Sbjct: 60 LADKKETDPHRLAQRQKQIDYGKNTIGYDRYCAQVP 95
BLAST of mRNA_M-pyrifera_M_contig98939.22756.1 vs. uniprot
Match: M4B5M8_HYAAE (SLBP_RNA_bind domain-containing protein n=1 Tax=Hyaloperonospora arabidopsidis (strain Emoy2) TaxID=559515 RepID=M4B5M8_HYAAE) HSP 1 Score: 57.8 bits (138), Expect = 6.400e-9 Identity = 26/36 (72.22%), Postives = 31/36 (86.11%), Query Frame = 0 Query: 3 FASDREEDPHRIAQRQKQIDYGKNTTGYDRYKSQVP 38 + ++E DPHR+AQRQKQIDYGKNT GYDRY +QVP Sbjct: 48 LSDEKETDPHRLAQRQKQIDYGKNTIGYDRYCAQVP 83
BLAST of mRNA_M-pyrifera_M_contig98939.22756.1 vs. uniprot
Match: A0A3F2S136_9STRA (SLBP_RNA_bind domain-containing protein n=1 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A3F2S136_9STRA) HSP 1 Score: 57.4 bits (137), Expect = 7.010e-9 Identity = 26/36 (72.22%), Postives = 30/36 (83.33%), Query Frame = 0 Query: 3 FASDREEDPHRIAQRQKQIDYGKNTTGYDRYKSQVP 38 A ++E DPHR+ QRQKQIDYGKNT GYDRY +QVP Sbjct: 29 LADEKEADPHRLTQRQKQIDYGKNTIGYDRYCAQVP 64
BLAST of mRNA_M-pyrifera_M_contig98939.22756.1 vs. uniprot
Match: D0NCY1_PHYIT (SLBP_RNA_bind domain-containing protein n=2 Tax=Phytophthora infestans TaxID=4787 RepID=D0NCY1_PHYIT) HSP 1 Score: 57.0 bits (136), Expect = 8.370e-9 Identity = 26/36 (72.22%), Postives = 30/36 (83.33%), Query Frame = 0 Query: 3 FASDREEDPHRIAQRQKQIDYGKNTTGYDRYKSQVP 38 A ++E DPHR+AQRQKQIDYGKNT GYD Y +QVP Sbjct: 31 LADEKETDPHRLAQRQKQIDYGKNTIGYDHYCAQVP 66 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig98939.22756.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig98939.22756.1 ID=prot_M-pyrifera_M_contig98939.22756.1|Name=mRNA_M-pyrifera_M_contig98939.22756.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=40bpback to top |