prot_M-pyrifera_M_contig97898.22533.1 (polypeptide) Macrocystis pyrifera P11B4 male
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig97898.22533.1 vs. uniprot
Match: A0A1B6YE65_9BACT (Peptidase_M14 domain-containing protein n=7 Tax=Bacteroidetes/Chlorobi group TaxID=68336 RepID=A0A1B6YE65_9BACT) HSP 1 Score: 69.3 bits (168), Expect = 2.440e-12 Identity = 37/55 (67.27%), Postives = 43/55 (78.18%), Query Frame = 0 Query: 1 MKDRLYSLKFSTNGLMPNTSFSTVGYYSKEE--ALASGYASNKNKKNAEGMAFAA 53 MKD+LYSLKFSTN L P+ SFS+VGYY K+ LASGYAS +NK+ A G AFAA Sbjct: 772 MKDKLYSLKFSTNALKPDPSFSSVGYYVKDADGVLASGYASEENKEKAAGKAFAA 826
BLAST of mRNA_M-pyrifera_M_contig97898.22533.1 vs. uniprot
Match: A0A356X1H4_9BACT (Uncharacterized protein (Fragment) n=1 Tax=Balneolaceae bacterium TaxID=2053516 RepID=A0A356X1H4_9BACT) HSP 1 Score: 67.0 bits (162), Expect = 6.990e-12 Identity = 34/54 (62.96%), Postives = 43/54 (79.63%), Query Frame = 0 Query: 1 MKDRLYSLKFSTNGLMPNTSFSTVGYYSKE-EALASGYASNKNKKNAEGMAFAA 53 + + LYSLKF +GL+P+T F TVGYY KE E LASGYAS +N++ A+GMAFAA Sbjct: 156 LPETLYSLKFGDDGLVPSTDFQTVGYYVKEGEVLASGYASEENREEAKGMAFAA 209
BLAST of mRNA_M-pyrifera_M_contig97898.22533.1 vs. uniprot
Match: A0A3M8G825_9BACT (Peptidase_M14 domain-containing protein n=1 Tax=Balneola sp. TaxID=2024824 RepID=A0A3M8G825_9BACT) HSP 1 Score: 67.0 bits (162), Expect = 1.590e-11 Identity = 35/55 (63.64%), Postives = 42/55 (76.36%), Query Frame = 0 Query: 1 MKDRLYSLKFSTNGLMPNTSFSTVGYY--SKEEALASGYASNKNKKNAEGMAFAA 53 M D+LYSLKF T+G+ P+ SF TVGYY +E LASGY+S +NKKNA G AFAA Sbjct: 773 MSDKLYSLKFRTDGIKPDPSFHTVGYYLDDPKEVLASGYSSAENKKNAAGKAFAA 827
BLAST of mRNA_M-pyrifera_M_contig97898.22533.1 vs. uniprot
Match: A0A2D9FWS2_9BACT (Peptidase_M14 domain-containing protein n=1 Tax=Balneola sp. TaxID=2024824 RepID=A0A2D9FWS2_9BACT) HSP 1 Score: 67.0 bits (162), Expect = 1.590e-11 Identity = 34/54 (62.96%), Postives = 43/54 (79.63%), Query Frame = 0 Query: 1 MKDRLYSLKFSTNGLMPNTSFSTVGYYSKE-EALASGYASNKNKKNAEGMAFAA 53 + + LYSLKF +GL+P+T F TVGYY KE E LASGYAS +N++ A+GMAFAA Sbjct: 776 LPETLYSLKFGDDGLVPSTDFQTVGYYVKEGEVLASGYASEENREEAKGMAFAA 829
BLAST of mRNA_M-pyrifera_M_contig97898.22533.1 vs. uniprot
Match: A0A521EEB5_9BACT (Zinc carboxypeptidase n=1 Tax=Gracilimonas mengyeensis TaxID=1302730 RepID=A0A521EEB5_9BACT) HSP 1 Score: 66.6 bits (161), Expect = 2.180e-11 Identity = 33/54 (61.11%), Postives = 44/54 (81.48%), Query Frame = 0 Query: 1 MKDRLYSLKFSTNGLMPNTSFSTVGYYSKE--EALASGYASNKNKKNAEGMAFA 52 + +R+YSLKF+ +GL+P+TS+ TVGYY K+ E LASGYAS +NK+ A GMAFA Sbjct: 776 LPERMYSLKFNDDGLVPSTSYQTVGYYVKDSDEVLASGYASQENKEKAAGMAFA 829
BLAST of mRNA_M-pyrifera_M_contig97898.22533.1 vs. uniprot
Match: A0A6M1SY13_9BACT (Peptidase_M14 domain-containing protein n=2 Tax=Balneolaceae bacterium YR4-1 TaxID=2709311 RepID=A0A6M1SY13_9BACT) HSP 1 Score: 57.8 bits (138), Expect = 2.890e-8 Identity = 31/54 (57.41%), Postives = 38/54 (70.37%), Query Frame = 0 Query: 1 MKDRLYSLKFSTNGLMPNTSFSTVGYYSKEEA--LASGYASNKNKKNAEGMAFA 52 + +RLYSLKFS L+P+T + TVGYY K+ LASGYAS KN + A G AFA Sbjct: 784 LDNRLYSLKFSDEALVPSTDWQTVGYYQKDAGSLLASGYASQKNLQKAAGNAFA 837
BLAST of mRNA_M-pyrifera_M_contig97898.22533.1 vs. uniprot
Match: A0A5D3YMW9_9BACT (Zinc carboxypeptidase n=2 Tax=Balneolaceae TaxID=1813606 RepID=A0A5D3YMW9_9BACT) HSP 1 Score: 54.7 bits (130), Expect = 3.540e-7 Identity = 29/54 (53.70%), Postives = 38/54 (70.37%), Query Frame = 0 Query: 1 MKDRLYSLKFSTNGLMPNTSFSTVGYYSKEE--ALASGYASNKNKKNAEGMAFA 52 M ++L+SLKFS L+P+T + VG+YSK+ LASGYAS +NKK G AFA Sbjct: 783 MPNKLFSLKFSDESLVPSTDWQVVGHYSKDSQSVLASGYASPENKKQVAGNAFA 836
BLAST of mRNA_M-pyrifera_M_contig97898.22533.1 vs. uniprot
Match: A0A6M1THK2_9BACT (Peptidase_M14 domain-containing protein n=1 Tax=Aliifodinibius halophilus TaxID=1736908 RepID=A0A6M1THK2_9BACT) HSP 1 Score: 51.2 bits (121), Expect = 5.930e-6 Identity = 26/54 (48.15%), Postives = 38/54 (70.37%), Query Frame = 0 Query: 1 MKDRLYSLKFSTNGLMPNTSFSTVGYYSKE--EALASGYASNKNKKNAEGMAFA 52 + ++L++LKFS L+P+T++ VG+Y K+ LASGYAS +NKK G AFA Sbjct: 784 LPNKLFTLKFSDESLVPSTNWQVVGHYDKDPQSVLASGYASAENKKQVAGNAFA 837
BLAST of mRNA_M-pyrifera_M_contig97898.22533.1 vs. uniprot
Match: A0A2N0VGT5_9BACT (Peptidase_M14 domain-containing protein n=1 Tax=Rhodohalobacter barkolensis TaxID=2053187 RepID=A0A2N0VGT5_9BACT) HSP 1 Score: 50.4 bits (119), Expect = 1.110e-5 Identity = 25/54 (46.30%), Postives = 38/54 (70.37%), Query Frame = 0 Query: 1 MKDRLYSLKFSTNGLMPNTSFSTVGYYSK--EEALASGYASNKNKKNAEGMAFA 52 +K++LYSL ++T+ ++P++S+ VGYY K E L SGYAS +N + A G FA Sbjct: 778 VKEKLYSLTYNTDQMVPSSSYQVVGYYEKDPENLLVSGYASQENIQKAAGNVFA 831
BLAST of mRNA_M-pyrifera_M_contig97898.22533.1 vs. uniprot
Match: A0A351CAD8_9BACT (Peptidase_M14 domain-containing protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A351CAD8_9BACT) HSP 1 Score: 50.4 bits (119), Expect = 1.110e-5 Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = 0 Query: 1 MKDRLYSLKFSTNGLMPNTSFSTVGYYSKEEA--LASGYASNKNKKNAEGMAFA 52 MK+ +Y+LKF + P++SF VG+Y ++ A LASG+AS++NKK G FA Sbjct: 779 MKETMYTLKFGSESFAPSSSFQMVGHYDRDAASVLASGFASDENKKKIAGNGFA 832 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig97898.22533.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 10 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig97898.22533.1 ID=prot_M-pyrifera_M_contig97898.22533.1|Name=mRNA_M-pyrifera_M_contig97898.22533.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=59bpback to top |