prot_M-pyrifera_M_contig97821.22526.1 (polypeptide) Macrocystis pyrifera P11B4 male
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig97821.22526.1 vs. uniprot
Match: A0A3L7SG14_9BACT (DUF1571 domain-containing protein n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A3L7SG14_9BACT) HSP 1 Score: 55.1 bits (131), Expect = 2.730e-7 Identity = 24/52 (46.15%), Postives = 35/52 (67.31%), Query Frame = 0 Query: 8 LDKAIQQLSTVHSYTARWVRQIRLYGSLRDEEHVDLKIRHQPFSVHMNWMDG 59 L++ + L+ YTA +V+Q + G L DE+ V+LKIRH PFSV+M W+ G Sbjct: 95 LERGLDYLAKTPDYTAAFVKQELVNGELLDEQEVELKIRHAPFSVYMKWVSG 146
BLAST of mRNA_M-pyrifera_M_contig97821.22526.1 vs. uniprot
Match: F0SIC0_RUBBR (Uncharacterized protein n=2 Tax=Rubinisphaera TaxID=1649490 RepID=F0SIC0_RUBBR) HSP 1 Score: 54.3 bits (129), Expect = 5.150e-7 Identity = 22/52 (42.31%), Postives = 37/52 (71.15%), Query Frame = 0 Query: 8 LDKAIQQLSTVHSYTARWVRQIRLYGSLRDEEHVDLKIRHQPFSVHMNWMDG 59 L++ I L V SYTA + R+ R+ G +++ + ++LK+RH PFSV+M W++G Sbjct: 100 LERGIDHLERVPSYTAIFEREERIDGEMKEPQQMELKLRHAPFSVYMKWLNG 151
BLAST of mRNA_M-pyrifera_M_contig97821.22526.1 vs. uniprot
Match: A0A1I3JZG3_9PLAN (Uncharacterized protein n=1 Tax=Planctomicrobium piriforme TaxID=1576369 RepID=A0A1I3JZG3_9PLAN) HSP 1 Score: 54.3 bits (129), Expect = 5.190e-7 Identity = 24/52 (46.15%), Postives = 33/52 (63.46%), Query Frame = 0 Query: 8 LDKAIQQLSTVHSYTARWVRQIRLYGSLRDEEHVDLKIRHQPFSVHMNWMDG 59 L+K S V YTA +Q RL G+L D + +DLK+RH+P+SV+M W G Sbjct: 104 LEKGCHNFSKVPDYTACMFKQERLNGALGDGQTIDLKVRHEPYSVYMKWQSG 155
BLAST of mRNA_M-pyrifera_M_contig97821.22526.1 vs. uniprot
Match: A0A518CMX6_9PLAN (Uncharacterized protein n=1 Tax=Polystyrenella longa TaxID=2528007 RepID=A0A518CMX6_9PLAN) HSP 1 Score: 54.3 bits (129), Expect = 5.310e-7 Identity = 20/52 (38.46%), Postives = 37/52 (71.15%), Query Frame = 0 Query: 8 LDKAIQQLSTVHSYTARWVRQIRLYGSLRDEEHVDLKIRHQPFSVHMNWMDG 59 L++ ++ L + YT +++Q R+ GS+ + ++LKIRH+PFSV+M W++G Sbjct: 134 LEEGLENLKQIPDYTTTFIKQERIAGSMTEPNLINLKIRHEPFSVYMKWLNG 185
BLAST of mRNA_M-pyrifera_M_contig97821.22526.1 vs. uniprot
Match: A0A836RHS8_9PLAN (DUF1571 domain-containing protein n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A836RHS8_9PLAN) HSP 1 Score: 52.0 bits (123), Expect = 2.710e-6 Identity = 22/52 (42.31%), Postives = 35/52 (67.31%), Query Frame = 0 Query: 8 LDKAIQQLSTVHSYTARWVRQIRLYGSLRDEEHVDLKIRHQPFSVHMNWMDG 59 L+K+ L V YTA + +Q R+ G L + + ++LK+RHQPFS++M W+ G Sbjct: 15 LEKSQHVLENVSDYTATFYKQERINGELSEGQLMELKMRHQPFSIYMKWLTG 66
BLAST of mRNA_M-pyrifera_M_contig97821.22526.1 vs. uniprot
Match: UPI0012F7A22C (DUF1571 domain-containing protein n=1 Tax=Schlesneria paludicola TaxID=360056 RepID=UPI0012F7A22C) HSP 1 Score: 52.0 bits (123), Expect = 3.410e-6 Identity = 20/52 (38.46%), Postives = 36/52 (69.23%), Query Frame = 0 Query: 8 LDKAIQQLSTVHSYTARWVRQIRLYGSLRDEEHVDLKIRHQPFSVHMNWMDG 59 L+K ++ L++ YTA +V+Q + G L DE+ +++K+RH PFS+++ W G Sbjct: 94 LEKGVEFLTSTPDYTALFVKQELVNGDLLDEQEMEMKVRHAPFSIYLKWTTG 145
BLAST of mRNA_M-pyrifera_M_contig97821.22526.1 vs. uniprot
Match: A0A5C5X554_9PLAN (Uncharacterized protein n=1 Tax=Thalassoglobus neptunius TaxID=1938619 RepID=A0A5C5X554_9PLAN) HSP 1 Score: 51.6 bits (122), Expect = 4.700e-6 Identity = 22/52 (42.31%), Postives = 34/52 (65.38%), Query Frame = 0 Query: 8 LDKAIQQLSTVHSYTARWVRQIRLYGSLRDEEHVDLKIRHQPFSVHMNWMDG 59 L K I+ +V YTA + +Q R+ G L D + ++LK++H+PFSV+M W G Sbjct: 102 LKKGIESFESVPDYTASFYKQERMNGVLGDGQTIELKMKHEPFSVYMKWESG 153
BLAST of mRNA_M-pyrifera_M_contig97821.22526.1 vs. uniprot
Match: A0A356A3P8_9PLAN (Uncharacterized protein n=2 Tax=Planctomycetaceae TaxID=126 RepID=A0A356A3P8_9PLAN) HSP 1 Score: 51.2 bits (121), Expect = 6.210e-6 Identity = 20/48 (41.67%), Postives = 34/48 (70.83%), Query Frame = 0 Query: 15 LSTVHSYTARWVRQIRLYGSLRDEEHVDLKIRHQPFSVHMNWMDGSQQ 62 + +VHSY A +Q+R+ G L+D E ++LK+RH+P++V+M W Q+ Sbjct: 85 IRSVHSYKAILEKQVRIDGVLQDPEEIELKVRHKPYAVYMQWKGDGQE 132
BLAST of mRNA_M-pyrifera_M_contig97821.22526.1 vs. uniprot
Match: A0A2E9VRG7_9PLAN (Uncharacterized protein n=2 Tax=Planctomycetaceae TaxID=126 RepID=A0A2E9VRG7_9PLAN) HSP 1 Score: 50.8 bits (120), Expect = 8.520e-6 Identity = 20/48 (41.67%), Postives = 33/48 (68.75%), Query Frame = 0 Query: 15 LSTVHSYTARWVRQIRLYGSLRDEEHVDLKIRHQPFSVHMNWMDGSQQ 62 + +V YTA +Q+R+ G L+D E +++K+RH+PFSV+M W Q+ Sbjct: 85 IQSVDRYTATLEKQVRVDGELQDPEEIEVKVRHKPFSVYMQWKGDGQE 132
BLAST of mRNA_M-pyrifera_M_contig97821.22526.1 vs. uniprot
Match: A0A3M1VB55_9BACT (DUF1571 domain-containing protein n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A3M1VB55_9BACT) HSP 1 Score: 50.4 bits (119), Expect = 1.230e-5 Identity = 22/55 (40.00%), Postives = 37/55 (67.27%), Query Frame = 0 Query: 5 YRNLDKAIQQLSTVHSYTARWVRQIRLYGSLRDEEHVDLKIRHQPFSVHMNWMDG 59 Y L +A ++L + +YTA +V+Q RL G+L D + + +++RH+PF+V M W G Sbjct: 154 YLMLAEAARRLERLDAYTATFVKQERLGGTLTDRQVIAMRVRHRPFAVWMEWKKG 208 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig97821.22526.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 15 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig97821.22526.1 ID=prot_M-pyrifera_M_contig97821.22526.1|Name=mRNA_M-pyrifera_M_contig97821.22526.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=62bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|