prot_M-pyrifera_M_contig96191.22170.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig96191.22170.1 vs. uniprot
Match: A0A2K1KX00_PHYPA (Anaphase-promoting complex subunit 5 n=2 Tax=Physcomitrium patens TaxID=3218 RepID=A0A2K1KX00_PHYPA) HSP 1 Score: 58.9 bits (141), Expect = 2.160e-7 Identity = 41/123 (33.33%), Postives = 61/123 (49.59%), Query Frame = 0 Query: 9 IEELRRMAPKVSAVHYLALVFEIQRRNVSNARDELHRYFDHQVYEHATRKRDRGANSNGKEGARRSSLL---PFALLNLASLHFLFSDYDEGVQAVSEAVRLAQASSDQGVLAVGLTWLHRLL 128 + +L ++AP + VHYL + +Q+ + D+LHRYFD+ G GA S + LL+L S+H F D+ +QA++EAVR+AQ +D LA L L LL Sbjct: 287 LTQLEKLAPDMMKVHYLRYLNHLQQSDYPATMDDLHRYFDYSA----------GMGGMSVGGASCDSSVGRFQAGLLSLGSMHAHFGHVDQAMQALNEAVRIAQQYNDDACLAHALAALCHLL 399 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig96191.22170.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig96191.22170.1 ID=prot_M-pyrifera_M_contig96191.22170.1|Name=mRNA_M-pyrifera_M_contig96191.22170.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=140bpback to top |