prot_M-pyrifera_M_contig95582.22033.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig95582.22033.1 vs. uniprot
Match: D7G3J7_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G3J7_ECTSI) HSP 1 Score: 82.8 bits (203), Expect = 3.120e-17 Identity = 36/49 (73.47%), Postives = 40/49 (81.63%), Query Frame = 0 Query: 1 CDPSAECVNTIGSYKCSCPLGEACVPWSGAGFCQNVTSSADCCTVDEEQ 49 C SAECVNTIGSY+CSCP EACVP SG G+C + SSADCCTVDEE+ Sbjct: 136 CHASAECVNTIGSYECSCPGREACVPRSGLGYCTGINSSADCCTVDEEK 184 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig95582.22033.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig95582.22033.1 ID=prot_M-pyrifera_M_contig95582.22033.1|Name=mRNA_M-pyrifera_M_contig95582.22033.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=51bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|