mRNA_M-pyrifera_M_contig95582.22033.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig95582.22033.1 vs. uniprot
Match: D7G3J7_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G3J7_ECTSI) HSP 1 Score: 82.8 bits (203), Expect = 3.120e-17 Identity = 36/49 (73.47%), Postives = 40/49 (81.63%), Query Frame = 1 Query: 1 CDPSAECVNTIGSYKCSCPLGEACVPWSGAGFCQNVTSSADCCTVDEEQ 147 C SAECVNTIGSY+CSCP EACVP SG G+C + SSADCCTVDEE+ Sbjct: 136 CHASAECVNTIGSYECSCPGREACVPRSGLGYCTGINSSADCCTVDEEK 184 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig95582.22033.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig95582.22033.1 >prot_M-pyrifera_M_contig95582.22033.1 ID=prot_M-pyrifera_M_contig95582.22033.1|Name=mRNA_M-pyrifera_M_contig95582.22033.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=51bp CDPSAECVNTIGSYKCSCPLGEACVPWSGAGFCQNVTSSADCCTVDEEQVback to top mRNA from alignment at M-pyrifera_M_contig95582:372..524- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig95582.22033.1 ID=mRNA_M-pyrifera_M_contig95582.22033.1|Name=mRNA_M-pyrifera_M_contig95582.22033.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=153bp|location=Sequence derived from alignment at M-pyrifera_M_contig95582:372..524- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig95582:372..524- >mRNA_M-pyrifera_M_contig95582.22033.1 ID=mRNA_M-pyrifera_M_contig95582.22033.1|Name=mRNA_M-pyrifera_M_contig95582.22033.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=306bp|location=Sequence derived from alignment at M-pyrifera_M_contig95582:372..524- (Macrocystis pyrifera P11B4 male)back to top |