prot_M-pyrifera_M_contig95450.22009.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig95450.22009.1 vs. uniprot
Match: A0A397TM77_9GLOM (Uncharacterized protein n=1 Tax=Glomus cerebriforme TaxID=658196 RepID=A0A397TM77_9GLOM) HSP 1 Score: 58.2 bits (139), Expect = 1.580e-6 Identity = 42/126 (33.33%), Postives = 63/126 (50.00%), Query Frame = 0 Query: 5 TKTEVVLELGVGLYNPSNVNILGVGSVCLDLFYNDTLSGEIVAQNADLLEGQNNVFFKGQLI---DTDPVLVSTMISTFLGGNASNVRGEGRHCDGTSPLFRAALASLALDTVLPG--SPIPLIRQ 125 T +++ L VGL+NPSNV I +G V DL + D G+++ QN L G+NNV Q D ++ F+ G ++ V +G + ALA+L L T +PG +P P+I Q Sbjct: 605 TAENMLINLSVGLFNPSNVKI-SMGDVVFDLNFQDQPMGKVIMQNFVLDRGENNVNVTAQFGPQGDAANKAGRELLDNFIIGKSNTVGIKGSTQSTPIASLQKALAALELTTSMPGLNTPKPIIEQ 729 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig95450.22009.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig95450.22009.1 ID=prot_M-pyrifera_M_contig95450.22009.1|Name=mRNA_M-pyrifera_M_contig95450.22009.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=193bpback to top |