mRNA_M-pyrifera_M_contig95450.22009.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig95450.22009.1 vs. uniprot
Match: A0A397TM77_9GLOM (Uncharacterized protein n=1 Tax=Glomus cerebriforme TaxID=658196 RepID=A0A397TM77_9GLOM) HSP 1 Score: 58.2 bits (139), Expect = 1.580e-6 Identity = 42/126 (33.33%), Postives = 63/126 (50.00%), Query Frame = 1 Query: 13 TKTEVVLELGVGLYNPSNVNILGVGSVCLDLFYNDTLSGEIVAQNADLLEGQNNVFFKGQLI---DTDPVLVSTMISTFLGGNASNVRGEGRHCDGTSPLFRAALASLALDTVLPG--SPIPLIRQ 375 T +++ L VGL+NPSNV I +G V DL + D G+++ QN L G+NNV Q D ++ F+ G ++ V +G + ALA+L L T +PG +P P+I Q Sbjct: 605 TAENMLINLSVGLFNPSNVKI-SMGDVVFDLNFQDQPMGKVIMQNFVLDRGENNVNVTAQFGPQGDAANKAGRELLDNFIIGKSNTVGIKGSTQSTPIASLQKALAALELTTSMPGLNTPKPIIEQ 729 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig95450.22009.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig95450.22009.1 >prot_M-pyrifera_M_contig95450.22009.1 ID=prot_M-pyrifera_M_contig95450.22009.1|Name=mRNA_M-pyrifera_M_contig95450.22009.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=193bp LADSTKTEVVLELGVGLYNPSNVNILGVGSVCLDLFYNDTLSGEIVAQNAback to top mRNA from alignment at M-pyrifera_M_contig95450:2..580+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig95450.22009.1 ID=mRNA_M-pyrifera_M_contig95450.22009.1|Name=mRNA_M-pyrifera_M_contig95450.22009.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=579bp|location=Sequence derived from alignment at M-pyrifera_M_contig95450:2..580+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig95450:2..580+ >mRNA_M-pyrifera_M_contig95450.22009.1 ID=mRNA_M-pyrifera_M_contig95450.22009.1|Name=mRNA_M-pyrifera_M_contig95450.22009.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=1158bp|location=Sequence derived from alignment at M-pyrifera_M_contig95450:2..580+ (Macrocystis pyrifera P11B4 male)back to top |