prot_M-pyrifera_M_contig95257.21975.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig95257.21975.1 vs. uniprot
Match: A0A2P6N761_9EUKA (Cyclin domain-containing protein n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6N761_9EUKA) HSP 1 Score: 53.5 bits (127), Expect = 1.200e-5 Identity = 38/127 (29.92%), Postives = 59/127 (46.46%), Query Frame = 0 Query: 4 REKVYDATFVDPPDIQPGRAANAHASLGLVSSVQSYRPAVELEAELDSRFLERHDWLPPELNVRLSSLRKVKHLLVQTAERIQAELVIPALAFSLLDRLILARRINAATLAPVAAATFLLAFKFLQP 130 + YD F+D PD+ G+ S+ + +L+++L+ +F +H W+ V+L +RKVK L + + ALA+ LLDRLI+ I L P A LL+ KF P Sbjct: 251 KRSQYDPDFIDDPDLTTGKHKTVLNLPFYRGSIIPFVRPDDLKSDLNDQFRRKHPWI--NAGVKLYKIRKVKKKLYDVIVDTKLDFSFLALAYVLLDRLIMRNVIFRENLKPYAVVCLLLSIKFNDP 375 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig95257.21975.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig95257.21975.1 ID=prot_M-pyrifera_M_contig95257.21975.1|Name=mRNA_M-pyrifera_M_contig95257.21975.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=133bpback to top |